Human NPM1/B23/NPM ORF/cDNA clone-Adenovirus particle (BC016768)
Cat. No.: vGMAP000237
Pre-made Human NPM1/B23/NPM Adenovirus for NPM1 overexpression in-vitro and in-vivo. The NPM1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified NPM1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
NPM1/B23 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP000237 | Human NPM1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP000237 |
Gene Name | NPM1 |
Accession Number | BC016768 |
Gene ID | 4869 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 885 bp |
Gene Alias | B23,NPM |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGAAGATTCGATGGACATGGACATGAGCCCCCTGAGGCCCCAGAACTATCTTTTCGGTTGTGAACTAAAGGCCGACAAAGATTATCACTTTAAGGTGGATAATGATGAAAATGAGCACCAGTTATCTTTAAGAACGGTCAGTTTAGGGGCTGGTGCAAAGGATGAGTTGCACATTGTTGAAGCAGAGGCAATGAATTACGAAGGCAGTCCAATTAAAGTAACACTGGCAACTTTGAAAATGTCTGTACAGCCAACGGTTTCCCTTGGGGGCTTTGAAATAACACCACCAGTGGTCTTAAGGTTGAAGTGTGGTTCAGGGCCAGTGCATATTAGTGGACAGCACTTAGTAGCTGTGGAGGAAGATGCAGAGTCAGAAGATGAAGAGGAGGAGGATGTGAAACTCTTAAGTATATCTGGAAAGCGGTCTGCCCCTGGAGGTGGTAGCAAGGTTCCACAGAAAAAAGTAAAACTTGCTGCTGATGAAGATGATGACGATGATGATGAAGAGGATGATGATGAAGATGATGATGGTGATGATTTTGATGATGAGGAAGCTGAAGAAAAAGCGCCAGTGAAGAAATCTATACGAGATACTCCAGCCAAAAATGCACAAAAGTCAAATCAGAATGGAAAAGACTCAAAACCATCATCAACACCAAGATCAAAAGGACAAGAATCCTTCAAGAAACAGGAAAAAACTCCTAAAACACCAAAAGGACCTAGTTCTGTAGAAGACATTAAAGCAAAAATGCAAGCAAGTATAGAAAAAGGTGGTTCTCTTCCCAAAGTGGAAGCCAAATTCATCAATTGTGTGAAGAATTGCTTCCGGATGACTGACCAAGAGGCTATTCAAGATCTCTGGCAGTGGAGGAAGTCTCTTTAA |
ORF Protein Sequence | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDGDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINCVKNCFRMTDQEAIQDLWQWRKSL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T45591-Ab | Anti-NPM1 monoclonal antibody |
Target Antigen | GM-Tg-g-T45591-Ag | NPM1 protein |
ORF Viral Vector | pGMLP000923 | Human NPM1 Lentivirus plasmid |
ORF Viral Vector | pGMLP005179 | Human NPM1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000021 | Human NPM1 Adenovirus plasmid |
ORF Viral Vector | pGMAP000065 | Human NPM1 Adenovirus plasmid |
ORF Viral Vector | pGMAP000113 | Human NPM1 Adenovirus plasmid |
ORF Viral Vector | pGMAP000237 | Human NPM1 Adenovirus plasmid |
ORF Viral Vector | vGMLP000923 | Human NPM1 Lentivirus particle |
ORF Viral Vector | vGMLP005179 | Human NPM1 Lentivirus particle |
ORF Viral Vector | vGMAP000021 | Human NPM1 Adenovirus particle |
ORF Viral Vector | vGMAP000065 | Human NPM1 Adenovirus particle |
ORF Viral Vector | vGMAP000113 | Human NPM1 Adenovirus particle |
ORF Viral Vector | vGMAP000237 | Human NPM1 Adenovirus particle |
Target information
Target ID | GM-T45591 |
Target Name | NPM1 |
Gene ID | 4869, 18148, 706883, 25498, 101094904, 479292, 614028, 100059112 |
Gene Symbol and Synonyms | B23,B23NP,NO38,NPM,NPM1 |
Uniprot Accession | P06748 |
Uniprot Entry Name | NPM_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000181163 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.