Human IFI27/P27 ORF/cDNA clone-Adenovirus particle (BC015492)

Cat. No.: vGMAP000314

Pre-made Human IFI27/P27 Adenovirus for IFI27 overexpression in-vitro and in-vivo. The IFI27 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IFI27-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IFI27/P27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000314 Human IFI27 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000314
Gene Name IFI27
Accession Number BC015492
Gene ID 3429
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 360 bp
Gene Alias P27
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCCTCTGCTCTCACCTCATCAGCAGTGACCAGTGTGGCCAAAGTGGTCAGGGTGGCCTCTGGCTCTGCCGTAGTTTTGCCCCTGGCCAGGATTGCTACAGTTGTGATTGGAGGAGTTGTGGCTGTGCCCATGGTGCTCAGTGCCATGGGCTTCACTGCGGCGGGAATCGCCTCGTCCTCCATAGCAGCCAAGATGATGTCCGCGGCGGCCATTGCCAATGGGGGTGGAGTTGCCTCGGGCAGCCTTGTGGCTACTCTGCAGTCACTGGGAGCAACTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTGCCATTGCGGCTGTCATTGCGAGGTTCTACTAG
ORF Protein Sequence MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0997-Ab Anti-IFI27 monoclonal antibody
    Target Antigen GM-Tg-g-IP0997-Ag IFI27 protein
    ORF Viral Vector pGMLP000465 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMLV001680 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMAP000314 Human IFI27 Adenovirus plasmid
    ORF Viral Vector pGMPC001580 Human IFI27 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000465 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMLV001680 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMAP000314 Human IFI27 Adenovirus particle


    Target information

    Target ID GM-IP0997
    Target Name IFI27
    Gene ID 3429, 700513
    Gene Symbol and Synonyms FAM14D,IFI27,ISG12,ISG12A,P27
    Uniprot Accession P40305
    Uniprot Entry Name IFI27_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000165949
    Target Classification Not Available

    Enables RNA polymerase II-specific DNA-binding transcription factor binding activity; identical protein binding activity; and lamin binding activity. Involved in several processes, including cellular protein metabolic process; defense response to other organism; and extrinsic apoptotic signaling pathway. Acts upstream of or within negative regulation of transcription by RNA polymerase II and regulation of protein export from nucleus. Located in mitochondrial membrane and nuclear inner membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.