Human IFI27/FAM14D/ISG12 ORF/cDNA clone-Lentivirus particle (NM_005532)

Cat. No.: vGMLP000465

Pre-made Human IFI27/FAM14D/ISG12 Lentiviral expression plasmid for IFI27 lentivirus packaging, IFI27 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFI27/FAM14D products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000465 Human IFI27 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000465
Gene Name IFI27
Accession Number NM_005532
Gene ID 3429
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 360 bp
Gene Alias FAM14D,ISG12,ISG12A,P27
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCCTCTGCTCTCACCTCATCAGCAGTGACCAGTGTGGCCAAAGTGGTCAGGGTGGCCTCTGGCTCTGCCGTAGTTTTGCCCCTGGCCAGGATTGCTACAGTTGTGATTGGAGGAGTTGTGGCTGTGCCCATGGTGCTCAGTGCCATGGGCTTCACTGCGGCGGGAATCGCCTCGTCCTCCATAGCAGCCAAGATGATGTCCGCGGCGGCCATTGCCAATGGGGGTGGAGTTGCCTCGGGCAGCCTTGTGGCTACTCTGCAGTCACTGGGAGCAACTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTGCCATTGCGGCTGTCATTGCGAGGTTCTACTAG
ORF Protein Sequence MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0997-Ab Anti-IFI27 monoclonal antibody
    Target Antigen GM-Tg-g-IP0997-Ag IFI27 protein
    ORF Viral Vector pGMLP000465 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMLV001680 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMAP000314 Human IFI27 Adenovirus plasmid
    ORF Viral Vector pGMPC001580 Human IFI27 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000465 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMLV001680 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMAP000314 Human IFI27 Adenovirus particle


    Target information

    Target ID GM-IP0997
    Target Name IFI27
    Gene ID 3429, 700513
    Gene Symbol and Synonyms FAM14D,IFI27,ISG12,ISG12A,P27
    Uniprot Accession P40305
    Uniprot Entry Name IFI27_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000165949
    Target Classification Not Available

    Enables RNA polymerase II-specific DNA-binding transcription factor binding activity; identical protein binding activity; and lamin binding activity. Involved in several processes, including cellular protein metabolic process; defense response to other organism; and extrinsic apoptotic signaling pathway. Acts upstream of or within negative regulation of transcription by RNA polymerase II and regulation of protein export from nucleus. Located in mitochondrial membrane and nuclear inner membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.