Human DEFB1/BD1/DEFB-1 ORF/cDNA clone-Lentivirus particle (NM_005218)

Cat. No.: vGMLP000008

Pre-made Human DEFB1/BD1/DEFB-1 Lentiviral expression plasmid for DEFB1 lentivirus packaging, DEFB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DEFB1/BD1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000008 Human DEFB1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000008
Gene Name DEFB1
Accession Number NM_005218
Gene ID 1672
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 207 bp
Gene Alias BD1,DEFB-1,DEFB101,HBD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAACTTCCTACCTTCTGCTGTTTACTCTCTGCTTACTTTTGTCTGAGATGGCCTCAGGTGGTAACTTTCTCACAGGCCTTGGCCACAGATCTGATCATTACAATTGCGTCAGCAGTGGAGGGCAATGTCTCTATTCTGCCTGCCCGATCTTTACCAAAATTCAAGGCACCTGTTACAGAGGGAAGGCCAAGTGCTGCAAGTGA
ORF Protein Sequence MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0855-Ab Anti-DEFB1/ BD1/ DEFB-101 functional antibody
    Target Antigen GM-Tg-g-SE0855-Ag DEFB1 protein
    ORF Viral Vector pGMLP000008 Human DEFB1 Lentivirus plasmid
    ORF Viral Vector vGMLP000008 Human DEFB1 Lentivirus particle


    Target information

    Target ID GM-SE0855
    Target Name DEFB1
    Gene ID 1672, 574187, 83687, 102902220, 611241, 102150198
    Gene Symbol and Synonyms BD1,CBD1,CDK4,DEFB-1,DEFB1,DEFB101,HBD1,RHBD-1
    Uniprot Accession P60022
    Uniprot Entry Name DEFB1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Ovary Cancer, Contrast - Induced Nephropathy, Contact with and (suspected) exposure to arsenic, Kidney transplant rejection
    Gene Ensembl ENSG00000164825
    Target Classification Not Available

    Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.