Human CXCL14/BMAC/BRAK ORF/cDNA clone-Lentivirus particle (NM_004887)
Cat. No.: vGMLP000121
Pre-made Human CXCL14/BMAC/BRAK Lentiviral expression plasmid for CXCL14 lentivirus packaging, CXCL14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CXCL14/BMAC products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000121 | Human CXCL14 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000121 |
| Gene Name | CXCL14 |
| Accession Number | NM_004887 |
| Gene ID | 9547 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 336 bp |
| Gene Alias | BMAC,BRAK,KEC,KS1,MIP-2g,MIP2G,NJAC,SCYB14 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGCTCCTGGCGGCCGCGCTGCTCCTGCTGCTGCTGGCGCTGTACACCGCGCGTGTGGACGGGTCCAAATGCAAGTGCTCCCGGAAGGGACCCAAGATCCGCTACAGCGACGTGAAGAAGCTGGAAATGAAGCCAAAGTACCCGCACTGCGAGGAGAAGATGGTTATCATCACCACCAAGAGCGTGTCCAGGTACCGAGGTCAGGAGCACTGCCTGCACCCCAAGCTGCAGAGCACCAAGCGCTTCATCAAGTGGTACAACGCCTGGAACGAGAAGCGCAGGGTCTACGAAGAATAG |
| ORF Protein Sequence | MRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0135-Ab | Anti-CXL14/ CXCL14/ BMAC functional antibody |
| Target Antigen | GM-Tg-g-SE0135-Ag | CXCL14 protein |
| Cytokine | cks-Tg-g-GM-SE0135 | chemokine (C-X-C motif) ligand 14 (CXCL14) protein & antibody |
| ORF Viral Vector | pGMLP000121 | Human CXCL14 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000121 | Human CXCL14 Lentivirus particle |
Target information
| Target ID | GM-SE0135 |
| Target Name | CXCL14 |
| Gene ID | 9547, 57266, 712076, 306748, 101087962, 610078, 511771, 100072697 |
| Gene Symbol and Synonyms | 1110031L23Rik,1200006I23Rik,BMAC,bolekine,BRAK,CXCL14,KEC,KS1,MIP-2g,MIP2G,MIP2gamma,NJAC,SCYB14 |
| Uniprot Accession | O95715 |
| Uniprot Entry Name | CXL14_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000145824 |
| Target Classification | Not Available |
This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


