Human FABP2/FABPI/I-FABP ORF/cDNA clone-Lentivirus particle (NM_000134)

Cat. No.: vGMLP000151

Pre-made Human FABP2/FABPI/I-FABP Lentiviral expression plasmid for FABP2 lentivirus packaging, FABP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FABP2/FABPI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000151 Human FABP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000151
Gene Name FABP2
Accession Number NM_000134
Gene ID 2169
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 399 bp
Gene Alias FABPI,I-FABP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAAATTCACAGTCAAAGAATCAAGCACTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAGCAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAAACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGACTTATGTATATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGA
ORF Protein Sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2115-Ab Anti-FABPI/ FABP2/ I-FABP monoclonal antibody
    Target Antigen GM-Tg-g-MP2115-Ag FABP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000151 Human FABP2 Lentivirus plasmid
    ORF Viral Vector vGMLP000151 Human FABP2 Lentivirus particle


    Target information

    Target ID GM-MP2115
    Target Name FABP2
    Gene ID 2169, 14079, 705475, 25598, 101093099, 119867213, 515768, 100034050
    Gene Symbol and Synonyms FABP,FABP2,FABPI,I-FABP
    Uniprot Accession P12104
    Uniprot Entry Name FABPI_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Perinatal necrotizing enterocolitis, Other diseases of intestines (K55-K64)
    Gene Ensembl ENSG00000145384
    Target Classification Not Available

    The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.