Human FABP2/FABPI/I-FABP ORF/cDNA clone-Lentivirus particle (NM_000134)
Cat. No.: vGMLP000151
Pre-made Human FABP2/FABPI/I-FABP Lentiviral expression plasmid for FABP2 lentivirus packaging, FABP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FABP2/FABPI products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000151 | Human FABP2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000151 |
| Gene Name | FABP2 |
| Accession Number | NM_000134 |
| Gene ID | 2169 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 399 bp |
| Gene Alias | FABPI,I-FABP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAAATTCACAGTCAAAGAATCAAGCACTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAGCAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAAACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGACTTATGTATATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGA |
| ORF Protein Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2115-Ab | Anti-FABPI/ FABP2/ I-FABP monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2115-Ag | FABP2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000151 | Human FABP2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000151 | Human FABP2 Lentivirus particle |
Target information
| Target ID | GM-MP2115 |
| Target Name | FABP2 |
| Gene ID | 2169, 14079, 705475, 25598, 101093099, 119867213, 515768, 100034050 |
| Gene Symbol and Synonyms | FABP,FABP2,FABPI,I-FABP |
| Uniprot Accession | P12104 |
| Uniprot Entry Name | FABPI_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Perinatal necrotizing enterocolitis, Other diseases of intestines (K55-K64) |
| Gene Ensembl | ENSG00000145384 |
| Target Classification | Not Available |
The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


