Human LST1/B144/D6S49E ORF/cDNA clone-Lentivirus particle (NM_205838)

Cat. No.: vGMLP000188

Pre-made Human LST1/B144/D6S49E Lentiviral expression plasmid for LST1 lentivirus packaging, LST1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LST1/B144 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000188 Human LST1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000188
Gene Name LST1
Accession Number NM_205838
Gene ID 7940
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 201 bp
Gene Alias B144,D6S49E,LST-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTATCGCGGAATGATGTAAAGAGGCTGGAGAGGAGCTGGGCCCAGGGCTCCTCAGAGCAGGAACTCCACTATGCATCTCTGCAGAGGCTGCCAGTGCCCAGCAGTGAGGGACCTGACCTCAGGGGCAGAGACAAGAGAGGCACCAAGGAGGATCCAAGAGCTGACTATGCCTGCATTGCTGAGAACAAACCCACCTGA
ORF Protein Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0775-Ab Anti-LST1/ B144/ D6S49E monoclonal antibody
    Target Antigen GM-Tg-g-MP0775-Ag LST1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000188 Human LST1 Lentivirus plasmid
    ORF Viral Vector vGMLP000188 Human LST1 Lentivirus particle


    Target information

    Target ID GM-MP0775
    Target Name LST1
    Gene ID 7940, 16988, 100141390, 64569, 101099801, 607208, 100296268, 100629969
    Gene Symbol and Synonyms B144,D6S49E,LST-1,LST1
    Uniprot Accession O00453
    Uniprot Entry Name LST1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000204482
    Target Classification Not Available

    The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.