Human PLP2/A4/A4LSB ORF/cDNA clone-Lentivirus particle (NM_002668)

Cat. No.: vGMLP000193

Pre-made Human PLP2/A4/A4LSB Lentiviral expression plasmid for PLP2 lentivirus packaging, PLP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PLP2/A4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000193 Human PLP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000193
Gene Name PLP2
Accession Number NM_002668
Gene ID 5355
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 459 bp
Gene Alias A4,A4LSB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGATTCTGAGCGCCTCTCGGCTCCTGGCTGCTGGGCCGCCTGCACCAACTTCTCGCGCACTCGAAAGGGAATCCTCCTGTTTGCTGAGATTATATTATGCCTGGTGATCCTGATCTGCTTCAGTGCCTCCACACCAGGCTACTCCTCCCTGTCGGTGATTGAGATGATCCTTGCTGCTATTTTCTTTGTTGTCTACATGTGTGACCTGCACACCAAGATACCATTCATCAACTGGCCCTGGAGTGATTTCTTCCGAACCCTCATAGCGGCAATCCTCTACCTGATCACCTCCATTGTTGTCCTTGTTGAGAGAGGAAACCACTCCAAAATCGTCGCAGGGGTACTGGGCCTAATCGCTACGTGCCTCTTTGGCTATGATGCCTATGTCACCTTCCCCGTTCGGCAGCCAAGACATACAGCAGCCCCCACTGACCCCGCAGATGGCCCGGTGTAG
ORF Protein Sequence MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T50072-Ab Anti-PLP2/ A4/ A4LSB monoclonal antibody
    Target Antigen GM-Tg-g-T50072-Ag PLP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000193 Human PLP2 Lentivirus plasmid
    ORF Viral Vector pGMPC000287 Human PLP2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000193 Human PLP2 Lentivirus particle


    Target information

    Target ID GM-T50072
    Target Name PLP2
    Gene ID 5355, 18824, 712869, 302562, 101101620, 100683201, 399683, 100052104
    Gene Symbol and Synonyms A4,A4-LSB,A4LSB,mIMA4,PLP2
    Uniprot Accession Q04941
    Uniprot Entry Name PLP2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000102007
    Target Classification Not Available

    This gene encodes an integral membrane protein that localizes to the endoplasmic reticulum in colonic epithelial cells. The encoded protein can multimerize and may function as an ion channel. A polymorphism in the promoter of this gene may be linked to an increased risk of X-linked cognitive disability. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Jan 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.