Human S100A4/18A2/42A ORF/cDNA clone-Lentivirus particle (NM_002961)

Cat. No.: vGMLP000284

Pre-made Human S100A4/18A2/42A Lentiviral expression plasmid for S100A4 lentivirus packaging, S100A4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to S100A4/18A2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000284 Human S100A4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000284
Gene Name S100A4
Accession Number NM_002961
Gene ID 6275
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 306 bp
Gene Alias 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAAGAGGGTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGGGAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAACTTGGACAGCAACAGGGACAACGAGGTGGACTTCCAAGAGTACTGTGTCTTCCTGTCCTGCATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCCCAGATAAGCAGCCCAGGAAGAAATGA
ORF Protein Sequence MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35265-Ab Anti-S10A4/ S100A4/ 18A2 functional antibody
    Target Antigen GM-Tg-g-T35265-Ag S100A4 protein
    ORF Viral Vector pGMLP000284 Human S100A4 Lentivirus plasmid
    ORF Viral Vector pGMLV000591 Human S100A4 Lentivirus plasmid
    ORF Viral Vector pGMLV001466 Human S100A4 Lentivirus plasmid
    ORF Viral Vector vGMLP000284 Human S100A4 Lentivirus particle
    ORF Viral Vector vGMLV000591 Human S100A4 Lentivirus particle
    ORF Viral Vector vGMLV001466 Human S100A4 Lentivirus particle


    Target information

    Target ID GM-T35265
    Target Name S100A4
    Gene ID 6275, 20198, 715115, 24615, 101083141, 403787, 282343, 100056181
    Gene Symbol and Synonyms 18A2,42A,CAPL,FSP1,metastasin,MTS1,P9KA,PEL98,pk9a,RNP9KA,S100A4
    Uniprot Accession P26447
    Uniprot Entry Name S10A4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000196154
    Target Classification Not Available

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.