Human S100A4/18A2/42A ORF/cDNA clone-Lentivirus particle (NM_002961.3)
Cat. No.: vGMLV001466
Pre-made Human S100A4/18A2/42A Lentiviral expression plasmid for S100A4 lentivirus packaging, S100A4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
S100A4/18A2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV001466 | Human S100A4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV001466 |
| Gene Name | S100A4 |
| Accession Number | NM_002961.3 |
| Gene ID | 6275 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 306 bp |
| Gene Alias | 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Blasticidin (BSD) |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAAGAGGGTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGGGAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAACTTGGACAGCAACAGGGACAACGAGGTGGACTTCCAAGAGTACTGTGTCTTCCTGTCCTGCATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCCCAGATAAGCAGCCCAGGAAGAAATGA |
| ORF Protein Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T35265-Ab | Anti-S10A4/ S100A4/ 18A2 functional antibody |
| Target Antigen | GM-Tg-g-T35265-Ag | S100A4 protein |
| ORF Viral Vector | pGMLP000284 | Human S100A4 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000591 | Human S100A4 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001466 | Human S100A4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000284 | Human S100A4 Lentivirus particle |
| ORF Viral Vector | vGMLV000591 | Human S100A4 Lentivirus particle |
| ORF Viral Vector | vGMLV001466 | Human S100A4 Lentivirus particle |
Target information
| Target ID | GM-T35265 |
| Target Name | S100A4 |
| Gene ID | 6275, 20198, 715115, 24615, 101083141, 403787, 282343, 100056181 |
| Gene Symbol and Synonyms | 18A2,42A,CAPL,FSP1,metastasin,MTS1,P9KA,PEL98,pk9a,RNP9KA,S100A4 |
| Uniprot Accession | P26447 |
| Uniprot Entry Name | S10A4_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Breast Cancer |
| Gene Ensembl | ENSG00000196154 |
| Target Classification | Not Available |
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


