Human CDC42EP3/BORG2/CEP3 ORF/cDNA clone-Lentivirus particle (NM_006449)
Cat. No.: vGMLP000436
Pre-made Human CDC42EP3/BORG2/CEP3 Lentiviral expression plasmid for CDC42EP3 lentivirus packaging, CDC42EP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CDC42EP3/BORG2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000436 | Human CDC42EP3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000436 |
Gene Name | CDC42EP3 |
Accession Number | NM_006449 |
Gene ID | 10602 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 765 bp |
Gene Alias | BORG2,CEP3,UB1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCAGCCAAGACCCCAATTTACCTGAAAGCAGCCAATAACAAGAAAGGAAAGAAATTTAAACTGAGGGACATTCTGTCTCCTGATATGATCAGTCCCCCGCTTGGAGACTTTCGCCACACCATCCACATTGGCAAAGAGGGCCAGCACGATGTCTTTGGAGATATTTCCTTTCTTCAAGGGAACTACGAGCTTTTACCTGGAAACCAGGAGAAAGCACACCTGGGCCAGTTCCCTGGGCATAATGAGTTCTTCCGGGCCAACAGCACCTCGGACTCTGTGTTCACAGAAACGCCCTCCCCGGTGCTCAAAAATGCCATCTCCCTCCCGACCATTGGAGGATCCCAAGCTCTCATGTTGCCCTTATTGTCACCAGTGACATTTAATTCCAAACAGGAGTCCTTCGGGCCAGCAAAGCTGCCCAGGCTTAGCTGCGAGCCCGTCATGGAGGAAAAAGCTCAGGAGAAAAGCAGTCTGTTGGAGAATGGGACAGTCCACCAGGGAGACACCTCGTGGGGCTCCAGCGGTTCTGCATCTCAGTCCAGCCAAGGCAGAGACAGCCACTCCTCCAGCCTGTCCGAACAGTACCCCGACTGGCCAGCCGAGGACATGTTTGACCATCCCACCCCATGCGAGCTCATCAAGGGAAAGACTAAGTCAGAGGAGTCCCTCTCTGACCTTACAGGTTCCCTCCTCTCCCTGCAGCTTGATCTTGGGCCCTCACTTTTGGATGAGGTGCTGAATGTAATGGATAAAAATAAGTAA |
ORF Protein Sequence | MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2044-Ab | Anti-BORG2/ CDC42EP3/ CEP3 monoclonal antibody |
Target Antigen | GM-Tg-g-MP2044-Ag | CDC42EP3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000436 | Human CDC42EP3 Lentivirus plasmid |
ORF Viral Vector | vGMLP000436 | Human CDC42EP3 Lentivirus particle |
Target information
Target ID | GM-MP2044 |
Target Name | CDC42EP3 |
Gene ID | 10602, 260409, 712377, 313838, 101100382, 475726, 538967, 100070148 |
Gene Symbol and Synonyms | 3200001F04Rik,BORG2,CDC42EP3,CEP3,UB1 |
Uniprot Accession | Q9UKI2 |
Uniprot Entry Name | BORG2_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000163171 |
Target Classification | Not Available |
This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.