Human CDC42EP3/BORG2/CEP3 ORF/cDNA clone-Lentivirus particle (NM_006449)

Cat. No.: vGMLP000436

Pre-made Human CDC42EP3/BORG2/CEP3 Lentiviral expression plasmid for CDC42EP3 lentivirus packaging, CDC42EP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CDC42EP3/BORG2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000436 Human CDC42EP3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000436
Gene Name CDC42EP3
Accession Number NM_006449
Gene ID 10602
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 765 bp
Gene Alias BORG2,CEP3,UB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAGCCAAGACCCCAATTTACCTGAAAGCAGCCAATAACAAGAAAGGAAAGAAATTTAAACTGAGGGACATTCTGTCTCCTGATATGATCAGTCCCCCGCTTGGAGACTTTCGCCACACCATCCACATTGGCAAAGAGGGCCAGCACGATGTCTTTGGAGATATTTCCTTTCTTCAAGGGAACTACGAGCTTTTACCTGGAAACCAGGAGAAAGCACACCTGGGCCAGTTCCCTGGGCATAATGAGTTCTTCCGGGCCAACAGCACCTCGGACTCTGTGTTCACAGAAACGCCCTCCCCGGTGCTCAAAAATGCCATCTCCCTCCCGACCATTGGAGGATCCCAAGCTCTCATGTTGCCCTTATTGTCACCAGTGACATTTAATTCCAAACAGGAGTCCTTCGGGCCAGCAAAGCTGCCCAGGCTTAGCTGCGAGCCCGTCATGGAGGAAAAAGCTCAGGAGAAAAGCAGTCTGTTGGAGAATGGGACAGTCCACCAGGGAGACACCTCGTGGGGCTCCAGCGGTTCTGCATCTCAGTCCAGCCAAGGCAGAGACAGCCACTCCTCCAGCCTGTCCGAACAGTACCCCGACTGGCCAGCCGAGGACATGTTTGACCATCCCACCCCATGCGAGCTCATCAAGGGAAAGACTAAGTCAGAGGAGTCCCTCTCTGACCTTACAGGTTCCCTCCTCTCCCTGCAGCTTGATCTTGGGCCCTCACTTTTGGATGAGGTGCTGAATGTAATGGATAAAAATAAGTAA
ORF Protein Sequence MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2044-Ab Anti-BORG2/ CDC42EP3/ CEP3 monoclonal antibody
    Target Antigen GM-Tg-g-MP2044-Ag CDC42EP3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000436 Human CDC42EP3 Lentivirus plasmid
    ORF Viral Vector vGMLP000436 Human CDC42EP3 Lentivirus particle


    Target information

    Target ID GM-MP2044
    Target Name CDC42EP3
    Gene ID 10602, 260409, 712377, 313838, 101100382, 475726, 538967, 100070148
    Gene Symbol and Synonyms 3200001F04Rik,BORG2,CDC42EP3,CEP3,UB1
    Uniprot Accession Q9UKI2
    Uniprot Entry Name BORG2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000163171
    Target Classification Not Available

    This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.