Human GPR3/ACCA ORF/cDNA clone-Lentivirus particle (NM_005281)

Cat. No.: vGMLP000590

Pre-made Human GPR3/ACCA Lentiviral expression plasmid for GPR3 lentivirus packaging, GPR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GPR3/ACCA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000590 Human GPR3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000590
Gene Name GPR3
Accession Number NM_005281
Gene ID 2827
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 993 bp
Gene Alias ACCA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGTGGGGTGCAGGCAGCCCTCTGGCCTGGCTCTCAGCTGGCTCAGGCAACGTGAATGTAAGCAGCGTGGGCCCAGCAGAGGGGCCCACAGGTCCAGCCGCACCACTGCCCTCGCCTAAGGCCTGGGATGTGGTGCTCTGCATCTCAGGCACCCTGGTGTCCTGCGAGAATGCGCTAGTGGTGGCCATCATCGTGGGCACTCCTGCCTTCCGTGCCCCCATGTTCCTGCTGGTGGGCAGCCTGGCCGTGGCAGACCTGCTGGCAGGCCTGGGCCTGGTCCTGCACTTTGCTGCTGTCTTCTGCATCGGCTCAGCGGAGATGAGCCTGGTGCTGGTTGGCGTGCTGGCAATGGCCTTTACCGCCAGCATCGGCAGTCTACTGGCCATCACTGTCGACCGCTACCTTTCTCTGTACAATGCCCTCACCTACTATTCAGAGACAACAGTGACACGGACCTATGTGATGCTGGCCTTAGTGTGGGGAGGTGCCCTGGGCCTGGGGCTGCTGCCTGTGCTGGCCTGGAACTGCCTGGATGGCCTGACCACATGTGGCGTGGTTTATCCACTCTCCAAGAACCATCTGGTAGTTCTGGCCATTGCCTTCTTCATGGTGTTTGGCATCATGCTGCAGCTCTACGCCCAAATCTGCCGCATCGTCTGCCGCCATGCCCAGCAGATTGCCCTTCAGCGGCACCTGCTGCCTGCCTCCCACTATGTGGCCACCCGCAAGGGCATTGCCACACTGGCCGTGGTGCTTGGAGCCTTTGCCGCCTGCTGGTTGCCCTTCACTGTCTACTGCCTGCTGGGTGATGCCCACTCTCCACCTCTCTACACCTATCTTACCTTGCTCCCTGCCACCTACAACTCCATGATCAACCCTATCATCTACGCCTTCCGCAACCAGGATGTGCAGAAAGTGCTGTGGGCTGTCTGCTGCTGCTGTTCCTCTTCCAAGATCCCCTTCCGATCCCGCTCCCCCAGTGATGTCTAG
ORF Protein Sequence MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T31227-Ab Anti-GPR3/ ACCA monoclonal antibody
    Target Antigen GM-Tg-g-T31227-Ag GPR3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000590 Human GPR3 Lentivirus plasmid
    ORF Viral Vector vGMLP000590 Human GPR3 Lentivirus particle


    Target information

    Target ID GM-T31227
    Target Name GPR3
    Gene ID 2827, 14748, 716033, 266769, 101082583, 487344, 540687, 100070910
    Gene Symbol and Synonyms ACCA,Gpcr20,Gpcr21,Gpcr3,GPR3
    Uniprot Accession P46089
    Uniprot Entry Name GPR3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000181773
    Target Classification GPCR

    This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.