Human GPR3/ACCA ORF/cDNA clone-Lentivirus particle (NM_005281)
Cat. No.: vGMLP000590
Pre-made Human GPR3/ACCA Lentiviral expression plasmid for GPR3 lentivirus packaging, GPR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GPR3/ACCA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000590 | Human GPR3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000590 |
Gene Name | GPR3 |
Accession Number | NM_005281 |
Gene ID | 2827 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 993 bp |
Gene Alias | ACCA |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATGTGGGGTGCAGGCAGCCCTCTGGCCTGGCTCTCAGCTGGCTCAGGCAACGTGAATGTAAGCAGCGTGGGCCCAGCAGAGGGGCCCACAGGTCCAGCCGCACCACTGCCCTCGCCTAAGGCCTGGGATGTGGTGCTCTGCATCTCAGGCACCCTGGTGTCCTGCGAGAATGCGCTAGTGGTGGCCATCATCGTGGGCACTCCTGCCTTCCGTGCCCCCATGTTCCTGCTGGTGGGCAGCCTGGCCGTGGCAGACCTGCTGGCAGGCCTGGGCCTGGTCCTGCACTTTGCTGCTGTCTTCTGCATCGGCTCAGCGGAGATGAGCCTGGTGCTGGTTGGCGTGCTGGCAATGGCCTTTACCGCCAGCATCGGCAGTCTACTGGCCATCACTGTCGACCGCTACCTTTCTCTGTACAATGCCCTCACCTACTATTCAGAGACAACAGTGACACGGACCTATGTGATGCTGGCCTTAGTGTGGGGAGGTGCCCTGGGCCTGGGGCTGCTGCCTGTGCTGGCCTGGAACTGCCTGGATGGCCTGACCACATGTGGCGTGGTTTATCCACTCTCCAAGAACCATCTGGTAGTTCTGGCCATTGCCTTCTTCATGGTGTTTGGCATCATGCTGCAGCTCTACGCCCAAATCTGCCGCATCGTCTGCCGCCATGCCCAGCAGATTGCCCTTCAGCGGCACCTGCTGCCTGCCTCCCACTATGTGGCCACCCGCAAGGGCATTGCCACACTGGCCGTGGTGCTTGGAGCCTTTGCCGCCTGCTGGTTGCCCTTCACTGTCTACTGCCTGCTGGGTGATGCCCACTCTCCACCTCTCTACACCTATCTTACCTTGCTCCCTGCCACCTACAACTCCATGATCAACCCTATCATCTACGCCTTCCGCAACCAGGATGTGCAGAAAGTGCTGTGGGCTGTCTGCTGCTGCTGTTCCTCTTCCAAGATCCCCTTCCGATCCCGCTCCCCCAGTGATGTCTAG |
ORF Protein Sequence | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T31227-Ab | Anti-GPR3/ ACCA monoclonal antibody |
Target Antigen | GM-Tg-g-T31227-Ag | GPR3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000590 | Human GPR3 Lentivirus plasmid |
ORF Viral Vector | vGMLP000590 | Human GPR3 Lentivirus particle |
Target information
Target ID | GM-T31227 |
Target Name | GPR3 |
Gene ID | 2827, 14748, 716033, 266769, 101082583, 487344, 540687, 100070910 |
Gene Symbol and Synonyms | ACCA,Gpcr20,Gpcr21,Gpcr3,GPR3 |
Uniprot Accession | P46089 |
Uniprot Entry Name | GPR3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000181773 |
Target Classification | GPCR |
This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.