Human GNRH1/GNRH/GRH ORF/cDNA clone-Lentivirus particle (NM_000825)
Cat. No.: vGMLP000781
Pre-made Human GNRH1/GNRH/GRH Lentiviral expression plasmid for GNRH1 lentivirus packaging, GNRH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GNRH1/GNRH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000781 | Human GNRH1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000781 |
| Gene Name | GNRH1 |
| Accession Number | NM_000825 |
| Gene ID | 2796 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 291 bp |
| Gene Alias | GNRH,GRH,LHRH,LNRH |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGCCTTAGAATGAAGCCAATTCAAAAACTCCTAGCTGGCCTTATTCTACTGACTTGGTGCGTGGAAGGCTGCTCCAGCCAGCACTGGTCCTATGGACTGCGCCCTGGAGGAAAGAGAGATGCCGAAAATTTGATTGATTCTTTCCAAGAGATAGTCAAAGAGGTTGGTCAACTGGCAGAAACCCAACGCTTCGAATGCACCACGCACCAGCCACGTTCTCCCCTCCGAGACCTGAAAGGAGCTCTGGAAAGTCTGATTGAAGAGGAAACTGGGCAGAAGAAGATTTAA |
| ORF Protein Sequence | MCLRMKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T18950-Ab | Anti-GON1/ GNRH1/ GNRH functional antibody |
| Target Antigen | GM-Tg-g-T18950-Ag | GNRH1 protein |
| ORF Viral Vector | pGMLP000781 | Human GNRH1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000781 | Human GNRH1 Lentivirus particle |
Target information
| Target ID | GM-T18950 |
| Target Name | GNRH1 |
| Gene ID | 2796, 14714, 613033, 25194, 101080783, 608671, 768325, 100630270 |
| Gene Symbol and Synonyms | GNRH,GNRH1,Gnrh2,Gnrha,GRH,hpg,LHRH,Lhrh1,LNRH,Rgnrhg1,SH-4 |
| Uniprot Accession | P01148 |
| Uniprot Entry Name | GON1_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000147437 |
| Target Classification | Not Available |
This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


