Human PTN/HARP/HB-GAM ORF/cDNA clone-Lentivirus particle (NM_002825)
Cat. No.: vGMLP000869
Pre-made Human PTN/HARP/HB-GAM Lentiviral expression plasmid for PTN lentivirus packaging, PTN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PTN/HARP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000869 | Human PTN Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000869 |
| Gene Name | PTN |
| Accession Number | NM_002825 |
| Gene ID | 5764 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 507 bp |
| Gene Alias | HARP,HB-GAM,HBBM,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF-1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGGCTCAACAGTACCAGCAGCAGCGTCGAAAATTTGCAGCTGCCTTCTTGGCATTCATTTTCATACTGGCAGCTGTGGATACTGCTGAAGCAGGGAAGAAAGAGAAACCAGAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAA |
| ORF Protein Sequence | MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T49522-Ab | Anti-PTN/ HARP/ HB-GAM monoclonal antibody |
| Target Antigen | GM-Tg-g-T49522-Ag | PTN VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000869 | Human PTN Lentivirus plasmid |
| ORF Viral Vector | pGMAD001512 | Human PTN Adenovirus plasmid |
| ORF Viral Vector | vGMLP000869 | Human PTN Lentivirus particle |
| ORF Viral Vector | vGMAD001512 | Human PTN Adenovirus particle |
Target information
| Target ID | GM-T49522 |
| Target Name | PTN |
| Gene ID | 5764, 19242, 709496, 24924, 101100041, 475509, 280904, 100064880 |
| Gene Symbol and Synonyms | HARP,HB-GAM,HBBM,HBBN,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF,OSF-1,Osf1,PTN |
| Uniprot Accession | P21246 |
| Uniprot Entry Name | PTN_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Lung Cancer |
| Gene Ensembl | ENSG00000105894 |
| Target Classification | Not Available |
The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


