Human PRSS2/TRY2/TRY8 ORF/cDNA clone-Lentivirus particle (NM_002770.3)
Cat. No.: vGMLP001201
Pre-made Human PRSS2/TRY2/TRY8 Lentiviral expression plasmid for PRSS2 lentivirus packaging, PRSS2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PRSS2/TRY2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001201 | Human PRSS2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001201 |
| Gene Name | PRSS2 |
| Accession Number | NM_002770.3 |
| Gene ID | 5645 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 744 bp |
| Gene Alias | TRY2,TRY8,TRYP2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAATCTACTTCTGATCCTTACCTTTGTTGCAGCTGCTGTTGCTGCCCCCTTTGATGATGATGACAAGATCGTTGGGGGCTACATCTGTGAGGAGAATTCTGTCCCCTACCAGGTGTCCTTGAATTCTGGCTACCACTTCTGCGGTGGCTCCCTCATCAGCGAACAGTGGGTGGTGTCAGCAGGTCACTGCTACAAGTCCCGCATCCAGGTGAGACTGGGAGAGCACAACATCGAAGTCCTGGAGGGGAATGAACAGTTCATCAATGCGGCCAAGATCATCCGCCACCCCAAATACAACAGCCGGACTCTGGACAATGACATCCTGCTGATCAAGCTCTCCTCACCTGCCGTCATCAATTCCCGCGTGTCCGCCATCTCTCTGCCCACTGCCCCTCCAGCTGCTGGCACCGAGTCCCTCATCTCCGGCTGGGGCAACACTCTGAGTTCTGGTGCCGACTACCCAGACGAGCTGCAGTGCCTGGATGCTCCTGTGCTGAGCCAGGCTGAGTGTGAAGCCTCCTACCCTGGAAAGATTACCAACAACATGTTCTGTGTGGGCTTCCTCGAGGGAGGCAAGGATTCCTGCCAGGGTGATTCTGGTGGCCCTGTGGTCTCCAATGGAGAGCTCCAAGGAATTGTCTCCTGGGGCTATGGCTGTGCCCAGAAGAACAGGCCTGGAGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAGGACACCATAGCTGCCAACAGCTAA |
| ORF Protein Sequence | MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1211-Ab | Anti-TRY2/ PRSS2/ TRY8 functional antibody |
| Target Antigen | GM-Tg-g-SE1211-Ag | PRSS2 protein |
| ORF Viral Vector | pGMLP001201 | Human PRSS2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001201 | Human PRSS2 Lentivirus particle |
Target information
| Target ID | GM-SE1211 |
| Target Name | PRSS2 |
| Gene ID | 5645, 698352, 101085707, 100686744, 282603 |
| Gene Symbol and Synonyms | PRSS2,try10,TRY2,TRY8,TRYP2,TRYP8 |
| Uniprot Accession | P07478 |
| Uniprot Entry Name | TRY2_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Pancreatitis, Acute pancreatitis |
| Gene Ensembl | ENSG00000275896 |
| Target Classification | Not Available |
This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysine or arginine residues. This protein is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. This protein has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, this enzyme is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


