Human RHOB/ARH6/ARHB ORF/cDNA clone-Lentivirus particle (NM_004040)

Cat. No.: vGMLP001841

Pre-made Human RHOB/ARH6/ARHB Lentiviral expression plasmid for RHOB lentivirus packaging, RHOB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RHOB/ARH6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001841 Human RHOB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001841
Gene Name RHOB
Accession Number NM_004040
Gene ID 388
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 591 bp
Gene Alias ARH6,ARHB,MST081,MSTP081,RHOH6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCATCCGCAAGAAGCTGGTGGTGGTGGGCGACGGCGCGTGTGGCAAGACGTGCCTGCTGATCGTGTTCAGTAAGGACGAGTTCCCCGAGGTGTACGTGCCCACCGTCTTCGAGAACTATGTGGCCGACATTGAGGTGGACGGCAAGCAGGTGGAGCTGGCGCTGTGGGACACGGCGGGCCAGGAGGACTACGACCGCCTGCGGCCGCTCTCCTACCCGGACACCGACGTCATTCTCATGTGCTTCTCGGTGGACAGCCCGGACTCGCTGGAGAACATCCCCGAGAAGTGGGTCCCCGAGGTGAAGCACTTCTGTCCCAATGTGCCCATCATCCTGGTGGCCAACAAAAAAGACCTGCGCAGCGACGAGCATGTCCGCACAGAGCTGGCCCGCATGAAGCAGGAACCCGTGCGCACGGATGACGGCCGCGCCATGGCCGTGCGCATCCAAGCCTACGACTACCTCGAGTGCTCTGCCAAGACCAAGGAAGGCGTGCGCGAGGTCTTCGAGACGGCCACGCGCGCCGCGCTGCAGAAGCGCTACGGCTCCCAGAACGGCTGCATCAACTGCTGCAAGGTGCTATGA
ORF Protein Sequence MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58361-Ab Anti-RHOB monoclonal antibody
    Target Antigen GM-Tg-g-T58361-Ag RHOB protein
    ORF Viral Vector pGMLP001028 Human RHOB Lentivirus plasmid
    ORF Viral Vector pGMLP001841 Human RHOB Lentivirus plasmid
    ORF Viral Vector pGMLP005661 Human RHOB Lentivirus plasmid
    ORF Viral Vector pGMPC001834 Human RHOB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001028 Human RHOB Lentivirus particle
    ORF Viral Vector vGMLP001841 Human RHOB Lentivirus particle
    ORF Viral Vector vGMLP005661 Human RHOB Lentivirus particle


    Target information

    Target ID GM-T58361
    Target Name RHOB
    Gene ID 388, 11852, 702141, 64373, 101099371, 403670, 515118, 100056328
    Gene Symbol and Synonyms ARH6,ARHB,MST081,MSTP081,RHO,RHOB,RHOH6
    Uniprot Accession P62745
    Uniprot Entry Name RHOB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000143878
    Target Classification Tumor-associated antigen (TAA)

    Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Involved in several processes, including cellular response to hydrogen peroxide; cellular response to ionizing radiation; and regulation of cell migration. Located in cleavage furrow and endosome membrane. Biomarker of breast cancer. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.