Human HRK/DP5/HARAKIRI ORF/cDNA clone-Lentivirus particle (NM_003806)
Cat. No.: vGMLP001870
Pre-made Human HRK/DP5/HARAKIRI Lentiviral expression plasmid for HRK lentivirus packaging, HRK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
HRK/DP5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP001870 | Human HRK Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP001870 |
Gene Name | HRK |
Accession Number | NM_003806 |
Gene ID | 8739 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 276 bp |
Gene Alias | DP5,HARAKIRI |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTGCCCGTGCCCCCTGCACCGCGGCCGCGGCCCCCCGGCCGTGTGCGCCTGCAGCGCGGGTCGCCTGGGGCTGCGCTCGTCCGCCGCGCAGCTCACCGCCGCCCGGCTCAAGGCGCTAGGCGACGAGCTGCACCAGCGCACCATGTGGCGGCGCCGCGCGCGGAGCCGGAGGGCGCCGGCGCCCGGCGCGCTCCCCACCTACTGGCCTTGGCTGTGCGCGGCCGCGCAGGTGGCGGCGCTGGCGGCCTGGCTGCTCGGCAGGCGGAACTTGTAG |
ORF Protein Sequence | MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0981-Ab | Anti-HRK monoclonal antibody |
Target Antigen | GM-Tg-g-IP0981-Ag | HRK protein |
ORF Viral Vector | pGMLP001870 | Human HRK Lentivirus plasmid |
ORF Viral Vector | vGMLP001870 | Human HRK Lentivirus particle |
Target information
Target ID | GM-IP0981 |
Target Name | HRK |
Gene ID | 8739, 12123, 107001036, 117271, 109493221, 612984, 787139, 100629981 |
Gene Symbol and Synonyms | Bid3,DP5,HARAKIRI,HRK |
Uniprot Accession | O00198 |
Uniprot Entry Name | HRK_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000135116 |
Target Classification | Not Available |
This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.