Human INSIG2/INSIG-2 ORF/cDNA clone-Lentivirus particle (NM_016133)

Cat. No.: vGMLP002126

Pre-made Human INSIG2/INSIG-2 Lentiviral expression plasmid for INSIG2 lentivirus packaging, INSIG2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to INSIG2/INSIG-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002126 Human INSIG2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002126
Gene Name INSIG2
Accession Number NM_016133
Gene ID 51141
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 678 bp
Gene Alias INSIG-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGAAGGAGAGACAGAGTCACCTGGGCCCAAAAAGTGTGGCCCATATATTTCATCTGTCACTAGCCAGAGTGTGAACTTGATGATTCGAGGAGTAGTGCTATTTTTTATTGGAGTATTTCTTGCATTAGTGTTAAATTTACTTCAGATTCAGAGAAATGTGACGCTCTTTCCACCTGATGTGATTGCAAGCATCTTTTCTTCTGCATGGTGGGTACCCCCATGCTGTGGCACGGCTTCAGCTGTGATTGGGTTATTATACCCCTGCATTGACAGACATCTAGGAGAACCACATAAATTTAAAAGAGAGTGGTCCAGTGTAATGCGGTGTGTAGCAGTCTTTGTTGGTATAAATCATGCCAGTGCTAAAGTGGATTTCGATAACAACATACAGTTGTCTCTCACACTGGCTGCACTATCCATTGGACTGTGGTGGACTTTTGATAGATCTAGAAGTGGTTTTGGCCTTGGAGTAGGAATTGCCTTCTTGGCAACTGTGGTCACTCAACTGCTAGTATATAATGGTGTTTACCAATATACATCTCCAGATTTCCTCTATGTTCGTTCTTGGTTACCATGTATATTTTTTGCTGGAGGCATAACAATGGGAAACATTGGTCGACAACTGGCAATGTACGAATGTAAAGTTATCGCAGAAAAATCTCATCAGGAATGA
ORF Protein Sequence MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1015-Ab Anti-INSIG2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1015-Ag INSIG2 protein
    ORF Viral Vector pGMLP002126 Human INSIG2 Lentivirus plasmid
    ORF Viral Vector vGMLP002126 Human INSIG2 Lentivirus particle


    Target information

    Target ID GM-IP1015
    Target Name INSIG2
    Gene ID 51141, 72999, 693654, 288985, 101083870, 610496, 534440, 100049957
    Gene Symbol and Synonyms 2900053I11Rik,C730043J18Rik,INSIG-2,INSIG2
    Uniprot Accession Q9Y5U4
    Uniprot Entry Name INSI2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000125629
    Target Classification Not Available

    The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.