Human FCER2/BLAST-2/CD23 ORF/cDNA clone-Lentivirus particle (NM_002002)
Cat. No.: vGMLP002266
Pre-made Human FCER2/BLAST-2/CD23 Lentiviral expression plasmid for FCER2 lentivirus packaging, FCER2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD23/FCER2/BLAST-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002266 | Human FCER2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002266 |
Gene Name | FCER2 |
Accession Number | NM_002002 |
Gene ID | 2208 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 966 bp |
Gene Alias | BLAST-2,CD23,CD23A,CLEC4J,FCE2,IGEBF |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGGAAGGTCAATATTCAGAGATCGAGGAGCTTCCCAGGAGGCGGTGTTGCAGGCGTGGGACTCAGATCGTGCTGCTGGGGCTGGTGACCGCCGCTCTGTGGGCTGGGCTGCTGACTCTGCTTCTCCTGTGGCACTGGGACACCACACAGAGTCTAAAACAGCTGGAAGAGAGGGCTGCCCGGAACGTCTCTCAAGTTTCCAAGAACTTGGAAAGCCACCACGGTGACCAGATGGCGCAGAAATCCCAGTCCACGCAGATTTCACAGGAACTGGAGGAACTTCGAGCTGAACAGCAGAGATTGAAATCTCAGGACTTGGAGCTGTCCTGGAACCTGAACGGGCTTCAAGCAGATCTGAGCAGCTTCAAGTCCCAGGAATTGAACGAGAGGAACGAAGCTTCAGATTTGCTGGAAAGACTCCGGGAGGAGGTGACAAAGCTAAGGATGGAGTTGCAGGTGTCCAGCGGCTTTGTGTGCAACACGTGCCCTGAAAAGTGGATCAATTTCCAACGGAAGTGCTACTACTTCGGCAAGGGCACCAAGCAGTGGGTCCACGCCCGGTATGCCTGTGACGACATGGAAGGGCAGCTGGTCAGCATCCACAGCCCGGAGGAGCAGGACTTCCTGACCAAGCATGCCAGCCACACCGGCTCCTGGATTGGCCTTCGGAACTTGGACCTGAAGGGGGAGTTTATCTGGGTGGATGGGAGCCACGTGGACTACAGCAACTGGGCTCCAGGGGAGCCCACCAGCCGGAGCCAGGGCGAGGACTGCGTGATGATGCGGGGCTCCGGTCGCTGGAACGACGCCTTCTGCGACCGTAAGCTGGGCGCCTGGGTGTGCGACCGGCTGGCCACATGCACGCCGCCAGCCAGCGAAGGTTCCGCGGAGTCCATGGGACCTGATTCAAGACCAGACCCTGACGGCCGCCTGCCCACCCCCTCTGCCCCTCTCCACTCTTGA |
ORF Protein Sequence | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-327 | Pre-Made Lumiliximab biosimilar, Whole mAb, Anti-FCER2/CD23 Antibody: Anti-BLAST-2A/CLEC4J/FCE2/FCErII/IGEBF therapeutic antibody |
Biosimilar | GMP-Bios-ab-250 | Pre-Made Gomiliximab biosimilar, Whole mAb, Anti-FCER2/CD23 Antibody: Anti-BLAST-2A/CLEC4J/FCE2/FCErII/IGEBF therapeutic antibody |
Target Antibody | GM-Tg-g-T67207-Ab | Anti-FCER2/ CD23/ BLAST-2 monoclonal antibody |
Target Antigen | GM-Tg-g-T67207-Ag | CD23/FCER2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002266 | Human FCER2 Lentivirus plasmid |
ORF Viral Vector | vGMLP002266 | Human FCER2 Lentivirus particle |
Target information
Target ID | GM-T67207 |
Target Name | CD23 |
Gene ID | 2208, 14128, 708980, 171075, 101096291, 484998, 407106, 100009715 |
Gene Symbol and Synonyms | BLAST-2,CD23,CD23A,CLEC4J,FCE2,FCER2,Fcer2a,FCErII,IGEBF,Ly-42 |
Uniprot Accession | P06734 |
Uniprot Entry Name | FCER2_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, INN Index |
Disease | Not Available |
Gene Ensembl | ENSG00000104921 |
Target Classification | Not Available |
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.