Human CD164/DFNA66/endolyn ORF/cDNA clone-Lentivirus particle (NM_006016)
Cat. No.: vGMLP002299
Pre-made Human CD164/DFNA66/endolyn Lentiviral expression plasmid for CD164 lentivirus packaging, CD164 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD164/DFNA66 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002299 | Human CD164 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002299 |
| Gene Name | CD164 |
| Accession Number | NM_006016 |
| Gene ID | 8763 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 594 bp |
| Gene Alias | DFNA66,endolyn,MGC-24,MGC-24v,MUC-24 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCGCGGCTCTCCCGCTCACTGCTTTGGGCCGCCACCTGCCTGGGCGTGCTCTGCGTGCTGTCCGCGGACAAGAACACGACCCAGCACCCGAACGTGACGACTTTAGCGCCCATCTCCAACGTAACCTCGGCGCCGGTGACGTCCCTCCCGCTGGTCACCACTCCGGCACCAGAAACCTGTGAAGGTCGAAACAGCTGCGTTTCCTGTTTTAATGTTAGCGTTGTTAATACTACCTGCTTTTGGATAGAATGTAAAGATGAGAGCTATTGTTCACATAACTCAACAGTTAGTGATTGTCAAGTGGGGAACACGACAGACTTCTGTTCCGTTTCCACGGCCACTCCAGTGCCAACAGCCAATTCTACAGCTAAACCCACAGTTCAGCCCTCCCCTTCTACAACTTCCAAGACAGTTACTACATCAGGTACAACAAATAACACTGTGACTCCAACCTCACAACCTGTGCGAAAGTCTACCTTTGATGCAGCCAGTTTCATTGGAGGAATTGTCCTGGTCTTGGGTGTGCAGGCTGTAATTTTCTTTCTTTATAAATTCTGCAAATCTAAAGAACGAAATTACCACACTCTGTAA |
| ORF Protein Sequence | MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0195-Ab | Anti-MUC24/ CD164/ DFNA66 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0195-Ag | CD164 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002299 | Human CD164 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002299 | Human CD164 Lentivirus particle |
Target information
| Target ID | GM-MP0195 |
| Target Name | CD164 |
| Gene ID | 8763, 53599, 699242, 83689, 101082314, 475020, 509820, 100630272 |
| Gene Symbol and Synonyms | A115,A24,CD164,DFNA66,endolyn,MGC-24,MGC-24v,MSSP,MUC-24 |
| Uniprot Accession | Q04900 |
| Uniprot Entry Name | MUC24_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Prostate Cancer |
| Gene Ensembl | ENSG00000135535 |
| Target Classification | Not Available |
This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


