Human CD164/DFNA66/endolyn ORF/cDNA clone-Lentivirus particle (NM_006016)

Cat. No.: vGMLP002299

Pre-made Human CD164/DFNA66/endolyn Lentiviral expression plasmid for CD164 lentivirus packaging, CD164 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD164/DFNA66 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002299 Human CD164 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002299
Gene Name CD164
Accession Number NM_006016
Gene ID 8763
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 594 bp
Gene Alias DFNA66,endolyn,MGC-24,MGC-24v,MUC-24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCGGCTCTCCCGCTCACTGCTTTGGGCCGCCACCTGCCTGGGCGTGCTCTGCGTGCTGTCCGCGGACAAGAACACGACCCAGCACCCGAACGTGACGACTTTAGCGCCCATCTCCAACGTAACCTCGGCGCCGGTGACGTCCCTCCCGCTGGTCACCACTCCGGCACCAGAAACCTGTGAAGGTCGAAACAGCTGCGTTTCCTGTTTTAATGTTAGCGTTGTTAATACTACCTGCTTTTGGATAGAATGTAAAGATGAGAGCTATTGTTCACATAACTCAACAGTTAGTGATTGTCAAGTGGGGAACACGACAGACTTCTGTTCCGTTTCCACGGCCACTCCAGTGCCAACAGCCAATTCTACAGCTAAACCCACAGTTCAGCCCTCCCCTTCTACAACTTCCAAGACAGTTACTACATCAGGTACAACAAATAACACTGTGACTCCAACCTCACAACCTGTGCGAAAGTCTACCTTTGATGCAGCCAGTTTCATTGGAGGAATTGTCCTGGTCTTGGGTGTGCAGGCTGTAATTTTCTTTCTTTATAAATTCTGCAAATCTAAAGAACGAAATTACCACACTCTGTAA
ORF Protein Sequence MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0195-Ab Anti-MUC24/ CD164/ DFNA66 monoclonal antibody
    Target Antigen GM-Tg-g-MP0195-Ag CD164 VLP (virus-like particle)
    ORF Viral Vector pGMLP002299 Human CD164 Lentivirus plasmid
    ORF Viral Vector vGMLP002299 Human CD164 Lentivirus particle


    Target information

    Target ID GM-MP0195
    Target Name CD164
    Gene ID 8763, 53599, 699242, 83689, 101082314, 475020, 509820, 100630272
    Gene Symbol and Synonyms A115,A24,CD164,DFNA66,endolyn,MGC-24,MGC-24v,MSSP,MUC-24
    Uniprot Accession Q04900
    Uniprot Entry Name MUC24_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000135535
    Target Classification Not Available

    This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.