Human CHIC2/BTL ORF/cDNA clone-Lentivirus particle (NM_012110)

Cat. No.: vGMLP002437

Pre-made Human CHIC2/BTL Lentiviral expression plasmid for CHIC2 lentivirus packaging, CHIC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CHIC2/BTL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002437 Human CHIC2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002437
Gene Name CHIC2
Accession Number NM_012110
Gene ID 26511
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias BTL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGATTTCGACGAAATCTATGAGGAAGAGGAGGACGAGGAGCGGGCCCTGGAGGAGCAGCTGCTCAAGTACTCGCCGGACCCGGTGGTCGTCCGCGGCTCCGGTCACGTCACCGTATTTGGACTGAGCAACAAATTTGAATCTGAATTCCCTTCTTCATTAACTGGAAAAGTAGCTCCTGAAGAATTTAAAGCCAGCATCAACAGAGTTAACAGTTGTCTTAAGAAGAACCTTCCTGTTAATGTACGTTGGCTACTTTGTGGCTGCCTTTGTTGCTGCTGCACATTAGGTTGCAGTATGTGGCCAGTTATTTGCCTCAGTAAAAGAACACGAAGATCGATTGAGAAGTTATTAGAATGGGAAAACAATAGGTTATACCACAAGCTGTGCTTGCATTGGAGACTGAGCAAAAGGAAATGTGAAACGAATAACATGATGGAATATGTCATCCTCATAGAATTTTTACCAAAGACACCGATTTTTCGACCAGATTAG
ORF Protein Sequence MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0258-Ab Anti-CHIC2/ BTL monoclonal antibody
    Target Antigen GM-Tg-g-MP0258-Ag CHIC2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002437 Human CHIC2 Lentivirus plasmid
    ORF Viral Vector vGMLP002437 Human CHIC2 Lentivirus particle


    Target information

    Target ID GM-MP0258
    Target Name CHIC2
    Gene ID 26511, 74277, 697359, 83835, 101091277, 100856618, 615190, 100054052
    Gene Symbol and Synonyms 1700081B18Rik,4930502K01Rik,BTL,CHIC2
    Uniprot Accession Q9UKJ5
    Uniprot Entry Name CHIC2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000109220
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.