Human MGST3/GST-III ORF/cDNA clone-Lentivirus particle (NM_004528)

Cat. No.: vGMLP002545

Pre-made Human MGST3/GST-III Lentiviral expression plasmid for MGST3 lentivirus packaging, MGST3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MGST3/GST-III products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002545 Human MGST3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002545
Gene Name MGST3
Accession Number NM_004528
Gene ID 4259
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 459 bp
Gene Alias GST-III
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGTCCTCTCTAAGGAATATGGTTTTGTGCTTCTAACTGGTGCTGCCAGCTTTATAATGGTGGCCCACCTAGCCATCAATGTTTCCAAGGCCCGCAAGAAGTACAAAGTGGAGTATCCTATCATGTACAGCACGGACCCTGAAAATGGGCACATCTTCAACTGCATTCAGCGAGCCCACCAGAACACGTTGGAAGTGTATCCTCCCTTCTTATTTTTTCTAGCTGTTGGAGGTGTTTACCACCCGCGTATAGCTTCTGGCCTGGGCTTGGCCTGGATTGTTGGACGAGTTCTTTATGCTTATGGCTATTACACGGGAGAACCCAGCAAGCGTAGTCGAGGAGCCCTGGGGTCCATCGCCCTCCTGGGCTTGGTGGGCACAACTGTGTGCTCTGCTTTCCAGCATCTTGGTTGGGTTAAAAGTGGCTTGGGCAGTGGACCCAAATGCTGCCATTAA
ORF Protein Sequence MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1188-Ab Anti-MGST3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1188-Ag MGST3 protein
    ORF Viral Vector pGMLP002545 Human MGST3 Lentivirus plasmid
    ORF Viral Vector vGMLP002545 Human MGST3 Lentivirus particle


    Target information

    Target ID GM-IP1188
    Target Name MGST3
    Gene ID 4259, 66447, 695275, 289197, 101080760, 609050, 507346, 100058514
    Gene Symbol and Synonyms 2010012L10Rik,2010306B17Rik,2700004G04Rik,GST-III,MGST3
    Uniprot Accession O14880
    Uniprot Entry Name MGST3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143198
    Target Classification Not Available

    This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.[provided by RefSeq, May 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.