Human SLC48A1/hHRG-1/HRG-1 ORF/cDNA clone-Lentivirus particle (NM_017842)

Cat. No.: vGMLP002578

Pre-made Human SLC48A1/hHRG-1/HRG-1 Lentiviral expression plasmid for SLC48A1 lentivirus packaging, SLC48A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SLC48A1/hHRG-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002578 Human SLC48A1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002578
Gene Name SLC48A1
Accession Number NM_017842
Gene ID 55652
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 441 bp
Gene Alias hHRG-1,HRG-1,HRG1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCCGTCCAGGCTGCAGCTCGGCCTCCGCGCCGCCTACTCCGGCATCAGCTCCGTGGCCGGCTTCTCCATCTTCCTCGTCTGGACGGTGGTCTACCGACAGCCGGGGACCGCGGCCATGGGAGGGCTCGCAGGGGTGCTGGCACTGTGGGTCCTGGTGACGCACGTGATGTACATGCAAGATTATTGGAGGACCTGGCTCAAGGGGCTGCGCGGCTTCTTCTTCGTGGGCGTCCTCTTCTCGGCCGTCTCCATCGCTGCCTTCTGCACCTTCCTCGTGCTGGCCATCACCCGGCATCAGAGCCTCACAGACCCCACCAGCTACTACCTCTCCAGCGTCTGGAGCTTCATTTCCTTCAAGTGGGCCTTCCTGCTCAGCCTCTATGCCCACCGCTACCGGGCTGACTTTGCTGACATCAGCATCCTCAGCGATTTCTGA
ORF Protein Sequence MAPSRLQLGLRAAYSGISSVAGFSIFLVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLKGLRGFFFVGVLFSAVSIAAFCTFLVLAITRHQSLTDPTSYYLSSVWSFISFKWAFLLSLYAHRYRADFADISILSDF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1632-Ab Anti-HRG1/ SLC48A1/ HRG-1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1632-Ag SLC48A1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002578 Human SLC48A1 Lentivirus plasmid
    ORF Viral Vector vGMLP002578 Human SLC48A1 Lentivirus particle


    Target information

    Target ID GM-MP1632
    Target Name SLC48A1
    Gene ID 55652, 67739, 704304, 300191, 101086985, 100855680, 784685, 100056613
    Gene Symbol and Synonyms 4930570C03Rik,hHRG-1,HRG,HRG-1,HRG1,SLC48A1
    Uniprot Accession Q6P1K1
    Uniprot Entry Name HRG1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000211584
    Target Classification Not Available

    Enables heme binding activity and heme transmembrane transporter activity. Involved in heme transport. Located in endosome membrane; lysosomal membrane; and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.