Human HLA-DMB/D6S221E/RING7 ORF/cDNA clone-Lentivirus particle (NM_002118)

Cat. No.: vGMLP002634

Pre-made Human HLA-DMB/D6S221E/RING7 Lentiviral expression plasmid for HLA-DMB lentivirus packaging, HLA-DMB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HLA-DMB/D6S221E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002634 Human HLA-DMB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002634
Gene Name HLA-DMB
Accession Number NM_002118
Gene ID 3109
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 792 bp
Gene Alias D6S221E,RING7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCACATTCCTGCCGCTGCTGCTGGGGCTCAGCCTGGGCTGCACAGGAGCAGGTGGCTTCGTGGCCCATGTGGAAAGCACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTCCTTCAACAAGGATCTGCTGACCTGCTGGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAATAGCTTGGCGAATGTCCTCTCACAGCACCTCAACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGCTTCAGAATTGTGCCACACACACCCAGCCCTTCTGGGGATCACTGACCAACAGGACACGGCCACCATCTGTGCAAGTAGCCAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTCTATCCAGCAGAAGTGACTATCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGCAGTGCGCACAAGACTGCCCAGCCCAATGGAGACTGGACATACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGGGGACACTTACACCTGTGTGGTAGAGCACACTGGGGCTCCTGAGCCCATCCTTCGGGACTGGACACCTGGGCTGTCCCCCATGCAGACCCTGAAGGTTTCTGTGTCTGCAGTGACTCTGGGCCTGGGCCTCATCATCTTCTCTCTTGGTGTGATCAGCTGGCGGAGAGCTGGCCACTCTAGTTACACTCCTCTTCCTGGGTCCAATTATTCAGAAGGATGGCACATTTCCTAG
ORF Protein Sequence MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0971-Ab Anti-HLA-DMB monoclonal antibody
    Target Antigen GM-Tg-g-IP0971-Ag HLA-DMB protein
    ORF Viral Vector pGMLP002634 Human HLA-DMB Lentivirus plasmid
    ORF Viral Vector pGMLP003873 Human HLA-DMB Lentivirus plasmid
    ORF Viral Vector vGMLP002634 Human HLA-DMB Lentivirus particle
    ORF Viral Vector vGMLP003873 Human HLA-DMB Lentivirus particle


    Target information

    Target ID GM-IP0971
    Target Name HLA-DMB
    Gene ID 3109, 15000, 100429857, 294273, 111556173, 607827, 282491, 100060996
    Gene Symbol and Synonyms BOLA-DMB,D6S221E,DLA-DMB,DMb,H-2Mb2,H2-DMb2,H2-Mb2,HLA-DMB,LOC100060996,LOC111556173,MAMU-DMB,RING7,RT1-DMb,RT1.DMb,RT1.Mb
    Uniprot Accession P28068
    Uniprot Entry Name DMB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000242574
    Target Classification Not Available

    HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.