Human APLNR/AGTRL1/APJ ORF/cDNA clone-Lentivirus particle (NM_005161)

Cat. No.: vGMLP002662

Pre-made Human APLNR/AGTRL1/APJ Lentiviral expression plasmid for APLNR lentivirus packaging, APLNR lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to APLNR/AGTRL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002662 Human APLNR Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002662
Gene Name APLNR
Accession Number NM_005161
Gene ID 187
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1143 bp
Gene Alias AGTRL1,APJ,APJR,HG11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAAGGTGGTGATTTTGACAACTACTATGGGGCAGACAACCAGTCTGAGTGTGAGTACACAGACTGGAAATCCTCGGGGGCCCTCATCCCTGCCATCTACATGTTGGTCTTCCTCCTGGGCACCACGGGCAACGGTCTGGTGCTCTGGACCGTGTTTCGGAGCAGCCGGGAGAAGAGGCGCTCAGCTGATATCTTCATTGCTAGCCTGGCGGTGGCTGACCTGACCTTCGTGGTGACGCTGCCCCTGTGGGCTACCTACACGTACCGGGACTATGACTGGCCCTTTGGGACCTTCTTCTGCAAGCTCAGCAGCTACCTCATCTTCGTCAACATGTACGCCAGCGTCTTCTGCCTCACCGGCCTCAGCTTCGACCGCTACCTGGCCATCGTGAGGCCAGTGGCCAATGCTCGGCTGAGGCTGCGGGTCAGCGGGGCCGTGGCCACGGCAGTTCTTTGGGTGCTGGCCGCCCTCCTGGCCATGCCTGTCATGGTGTTACGCACCACCGGGGACTTGGAGAACACCACTAAGGTGCAGTGCTACATGGACTACTCCATGGTGGCCACTGTGAGCTCAGAGTGGGCCTGGGAGGTGGGCCTTGGGGTCTCGTCCACCACCGTGGGCTTTGTGGTGCCCTTCACCATCATGCTGACCTGTTACTTCTTCATCGCCCAAACCATCGCTGGCCACTTCCGCAAGGAACGCATCGAGGGCCTGCGGAAGCGGCGCCGGCTGCTCAGCATCATCGTGGTGCTGGTGGTGACCTTTGCCCTGTGCTGGATGCCCTACCACCTGGTGAAGACGCTGTACATGCTGGGCAGCCTGCTGCACTGGCCCTGTGACTTTGACCTCTTCCTCATGAACATCTTCCCCTACTGCACCTGCATCAGCTACGTCAACAGCTGCCTCAACCCCTTCCTCTATGCCTTTTTCGACCCCCGCTTCCGCCAGGCCTGCACCTCCATGCTCTGCTGTGGCCAGAGCAGGTGCGCAGGCACCTCCCACAGCAGCAGTGGGGAGAAGTCAGCCAGCTACTCTTCGGGGCACAGCCAGGGGCCCGGCCCCAACATGGGCAAGGGTGGAGAACAGATGCACGAGAAATCCATCCCCTACAGCCAGGAGACCCTTGTGGTTGACTAG
ORF Protein Sequence MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T65783-Ab Anti-APJ/ APLNR/ AGTRL1 monoclonal antibody
    Target Antigen GM-Tg-g-T65783-Ag APLNR VLP (virus-like particle)
    ORF Viral Vector pGMLP002662 Human APLNR Lentivirus plasmid
    ORF Viral Vector vGMLP002662 Human APLNR Lentivirus particle


    Target information

    Target ID GM-T65783
    Target Name APLNR
    Gene ID 187, 23796, 706823, 83518, 101088782, 483497, 615435, 100066889
    Gene Symbol and Synonyms AGTRL1,APJ,APJR,APLNR,HG11,msr/apj
    Uniprot Accession P35414
    Uniprot Entry Name APJ_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000134817
    Target Classification GPCR

    This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.