Human SERPINF1/EPC-1/OI12 ORF/cDNA clone-Lentivirus particle (NM_001329905)
Cat. No.: vGMLP002696
Pre-made Human SERPINF1/EPC-1/OI12 Lentiviral expression plasmid for SERPINF1 lentivirus packaging, SERPINF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SERPINF1/EPC-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002696 | Human SERPINF1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002696 |
Gene Name | SERPINF1 |
Accession Number | NM_001329905 |
Gene ID | 5176 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 696 bp |
Gene Alias | EPC-1,OI12,OI6,PEDF,PIG35 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAAGGGAAGCTCGCCAGGTCCACAAAGGAAATTCCCGATGAGATCAGCATTCTCCTTCTCGGTGTGGCGCACTTCAAGGGGCAGTGGGTAACAAAGTTTGACTCCAGAAAGACTTCCCTCGAGGATTTCTACTTGGATGAAGAGAGGACCGTGAGGGTCCCCATGATGTCGGACCCTAAGGCTGTTTTACGCTATGGCTTGGATTCAGATCTCAGCTGCAAGATTGCCCAGCTGCCCTTGACCGGAAGCATGAGTATCATCTTCTTCCTGCCCCTGAAAGTGACCCAGAATTTGACCTTGATAGAGGAGAGCCTCACCTCCGAGTTCATTCATGACATAGACCGAGAACTGAAGACCGTGCAGGCGGTCCTCACTGTCCCCAAGCTGAAGCTGAGTTATGAAGGCGAAGTCACCAAGTCCCTGCAGGAGATGAAGCTGCAATCCTTGTTTGATTCACCAGACTTTAGCAAGATCACAGGCAAACCCATCAAGCTGACTCAGGTGGAACACCGGGCTGGCTTTGAGTGGAACGAGGATGGGGCGGGAACCACCCCCAGCCCAGGGCTGCAGCCTGCCCACCTCACCTTCCCGCTGGACTATCACCTTAACCAGCCTTTCATCTTCGTACTGAGGGACACAGACACAGGGGCCCTTCTCTTCATTGGCAAGATTCTGGACCCCAGGGGCCCCTAA |
ORF Protein Sequence | MKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T54447-Ab | Anti-PEDF/ SERPINF1/ EPC-1 functional antibody |
Target Antigen | GM-Tg-g-T54447-Ag | SERPINF1 protein |
ORF Viral Vector | pGMLP002696 | Human SERPINF1 Lentivirus plasmid |
ORF Viral Vector | pGMLV001287 | Human SERPINF1 Lentivirus plasmid |
ORF Viral Vector | pGMLV001341 | Human Serpinf1 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000386 | Human SERPINF1 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMPC000744 | Human SERPINF1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001020 | Human SERPINF1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001028 | Human SERPINF1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002696 | Human SERPINF1 Lentivirus particle |
ORF Viral Vector | vGMLV001287 | Human SERPINF1 Lentivirus particle |
ORF Viral Vector | vGMLV001341 | Human Serpinf1 Lentivirus particle |
ORF Viral Vector | vGMAAV000386 | Human SERPINF1 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T54447 |
Target Name | SERPINF1 |
Gene ID | 5176, 20317, 721262, 287526, 101099915, 611276, 281386, 100072415 |
Gene Symbol and Synonyms | Dmrs91,EPC-1,OI12,OI6,PEDF,Pedfl,PIG35,Sdf3,SERPINF1 |
Uniprot Accession | P36955 |
Uniprot Entry Name | PEDF_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Complications of kidney transplant, Dent disease, Diabetic Nephropathy, Perinatal necrotizing enterocolitis |
Gene Ensembl | ENSG00000132386 |
Target Classification | Not Available |
This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI. [provided by RefSeq, Aug 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.