Human ATP1B2/AMOG ORF/cDNA clone-Lentivirus particle (NM_001678)

Cat. No.: vGMLP002716

Pre-made Human ATP1B2/AMOG Lentiviral expression plasmid for ATP1B2 lentivirus packaging, ATP1B2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ATP1B2/AMOG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002716 Human ATP1B2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002716
Gene Name ATP1B2
Accession Number NM_001678
Gene ID 482
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 873 bp
Gene Alias AMOG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCATCCAGAAAGAGAAGAAGAGCTGCGGGCAGGTGGTTGAGGAGTGGAAGGAGTTCGTGTGGAACCCGAGGACGCACCAGTTTATGGGCCGCACCGGGACCAGCTGGGCCTTTATCCTCCTCTTCTACCTCGTTTTTTATGGGTTCCTCACCGCCATGTTCACCCTCACCATGTGGGTGATGCTGCAGACTGTCTCCGACCATACCCCCAAGTACCAGGACCGACTGGCCACACCGGGCTTGATGATTCGCCCCAAGACTGAGAACCTTGATGTCATTGTCAATGTCAGTGACACTGAAAGCTGGGACCAGCATGTTCAGAAGCTCAACAAGTTCTTGGAGCCTTACAACGACTCTATCCAAGCCCAAAAGAATGATGTCTGCCGCCCTGGACGCTATTACGAACAGCCAGATAATGGAGTCCTCAACTACCCCAAACGTGCCTGCCAATTCAACCGGACCCAGCTGGGCAACTGCTCCGGCATTGGGGACTCCACCCACTATGGTTACAGCACTGGGCAGCCCTGTGTCTTCATCAAGATGAACCGGGTCATCAACTTCTATGCAGGAGCAAACCAGAGCATGAATGTTACCTGTGCTGGGAAGCGAGATGAAGATGCTGAGAATCTCGGCAACTTCGTCATGTTCCCCGCCAACGGCAACATCGACCTCATGTACTTCCCCTACTATGGCAAAAAGTTCCACGTGAACTACACACAGCCCCTGGTGGCTGTGAAGTTCCTGAATGTGACCCCCAACGTGGAGGTGAATGTAGAATGTCGCATCAACGCCGCCAACATCGCCACAGACGATGAGCGAGACAAGTTCGCCGGCCGCGTGGCCTTCAAACTCCGCATCAACAAAACCTGA
ORF Protein Sequence MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA178-Ab Anti-AT1B2/ ATP1B2/ AMOG monoclonal antibody
    Target Antigen GM-Tg-g-TA178-Ag ATP1B2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002716 Human ATP1B2 Lentivirus plasmid
    ORF Viral Vector vGMLP002716 Human ATP1B2 Lentivirus particle


    Target information

    Target ID GM-TA178
    Target Name ATP1B2
    Gene ID 482, 11932, 716093, 24214, 101100258, 489479, 282562, 100073014
    Gene Symbol and Synonyms AMOG,ATP1B2,Atpb-2,ATPB2,ATPB2S,RATATPB2S
    Uniprot Accession P14415
    Uniprot Entry Name AT1B2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000129244
    Target Classification Not Available

    The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.