Human CD82/4F9/C33 ORF/cDNA clone-Lentivirus particle (NM_002231)
Cat. No.: vGMLP002734
Pre-made Human CD82/4F9/C33 Lentiviral expression plasmid for CD82 lentivirus packaging, CD82 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD82/4F9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002734 | Human CD82 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002734 |
Gene Name | CD82 |
Accession Number | NM_002231 |
Gene ID | 3732 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 804 bp |
Gene Alias | 4F9,C33,GR15,IA4,KAI1,R2,SAR2,ST6,TSPAN27 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCTCAGCCTGTATCAAAGTCACCAAATACTTTCTCTTCCTCTTCAACTTGATCTTCTTTATCCTGGGCGCAGTGATCCTGGGCTTCGGGGTGTGGATCCTGGCCGACAAGAGCAGTTTCATCTCTGTCCTGCAAACCTCCTCCAGCTCGCTTAGGATGGGGGCCTATGTCTTCATCGGCGTGGGGGCAGTCACTATGCTCATGGGCTTCCTGGGCTGCATCGGCGCCGTCAACGAGGTCCGCTGCCTGCTGGGGCTGTACTTTGCTTTCCTGCTCCTGATCCTCATTGCCCAGGTGACGGCCGGGGCCCTCTTCTACTTCAACATGGGCAAGCTGAAGCAGGAGATGGGCGGCATCGTGACTGAGCTCATTCGAGACTACAACAGCAGTCGCGAGGACAGCCTGCAGGATGCCTGGGACTACGTGCAGGCTCAGGTGAAGTGCTGCGGCTGGGTCAGCTTCTACAACTGGACAGACAACGCTGAGCTCATGAATCGCCCTGAGGTCACCTACCCCTGTTCCTGCGAAGTCAAGGGGGAAGAGGACAACAGCCTTTCTGTGAGGAAGGGCTTCTGCGAGGCCCCCGGCAACAGGACCCAGAGTGGCAACCACCCTGAGGACTGGCCTGTGTACCAGGAGGGCTGCATGGAGAAGGTGCAGGCGTGGCTGCAGGAGAACCTGGGCATCATCCTCGGCGTGGGCGTGGGTGTGGCCATCATCGAGCTCCTGGGGATGGTCCTGTCCATCTGCTTGTGCCGGCACGTCCATTCCGAAGACTACAGCAAGGTCCCCAAGTACTGA |
ORF Protein Sequence | MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0218-Ab | Anti-CD82/ 4F9/ C33 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0218-Ag | CD82 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002734 | Human CD82 Lentivirus plasmid |
ORF Viral Vector | pGMLP004034 | Human CD82 Lentivirus plasmid |
ORF Viral Vector | vGMLP002734 | Human CD82 Lentivirus particle |
ORF Viral Vector | vGMLP004034 | Human CD82 Lentivirus particle |
Target information
Target ID | GM-MP0218 |
Target Name | CD82 |
Gene ID | 3732, 12521, 715606, 83628, 101084137, 119864234, 506713, 100056000 |
Gene Symbol and Synonyms | 4F9,C33,CD82,GR15,IA4,KAI1,R2,SAR2,ST6,TSPAN27 |
Uniprot Accession | P27701 |
Uniprot Entry Name | CD82_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000085117 |
Target Classification | Tumor-associated antigen (TAA) |
This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.