Human CRYAB/CMD1II/CRYA2 ORF/cDNA clone-Lentivirus particle (NM_001885)

Cat. No.: vGMLP002745

Pre-made Human CRYAB/CMD1II/CRYA2 Lentiviral expression plasmid for CRYAB lentivirus packaging, CRYAB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CRYAB/CMD1II products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002745 Human CRYAB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002745
Gene Name CRYAB
Accession Number NM_001885
Gene ID 1410
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 528 bp
Gene Alias CMD1II,CRYA2,CTPP2,CTRCT16,HEL-S-101,HSPB5,MFM2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACATCGCCATCCACCACCCCTGGATCCGCCGCCCCTTCTTTCCTTTCCACTCCCCCAGCCGCCTCTTTGACCAGTTCTTCGGAGAGCACCTGTTGGAGTCTGATCTTTTCCCGACGTCTACTTCCCTGAGTCCCTTCTACCTTCGGCCACCCTCCTTCCTGCGGGCACCCAGCTGGTTTGACACTGGACTCTCAGAGATGCGCCTGGAGAAGGACAGGTTCTCTGTCAACCTGGATGTGAAGCACTTCTCCCCAGAGGAACTCAAAGTTAAGGTGTTGGGAGATGTGATTGAGGTGCATGGAAAACATGAAGAGCGCCAGGATGAACATGGTTTCATCTCCAGGGAGTTCCACAGGAAATACCGGATCCCAGCTGATGTAGACCCTCTCACCATTACTTCATCCCTGTCATCTGATGGGGTCCTCACTGTGAATGGACCAAGGAAACAGGTCTCTGGCCCTGAGCGCACCATTCCCATCACCCGTGAAGAGAAGCCTGCTGTCACCGCAGCCCCCAAGAAATAG
ORF Protein Sequence MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0616-Ab Anti-CRYAB monoclonal antibody
    Target Antigen GM-Tg-g-IP0616-Ag CRYAB protein
    ORF Viral Vector pGMLP002745 Human CRYAB Lentivirus plasmid
    ORF Viral Vector pGMLV000870 Human CRYAB Lentivirus plasmid
    ORF Viral Vector pGMPC000454 Human CRYAB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000968 Human CRYAB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002745 Human CRYAB Lentivirus particle
    ORF Viral Vector vGMLV000870 Human CRYAB Lentivirus particle


    Target information

    Target ID GM-IP0616
    Target Name CRYAB
    Gene ID 1410, 12955, 710747, 25420, 101092640, 479441, 281719, 100061921
    Gene Symbol and Synonyms AACRYA,CMD1II,Crya-2,CRYA2,CRYAB,CTPP2,CTRCT16,HEL-S-101,HSPB5,MFM2,P23
    Uniprot Accession P02511
    Uniprot Entry Name CRYAB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Breast Cancer
    Gene Ensembl ENSG00000109846
    Target Classification Not Available

    Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2019]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.