Human CRYAB/CMD1II/CRYA2 ORF/cDNA clone-Lentivirus particle (NM_001885.2)
Cat. No.: vGMLV000870
Pre-made Human CRYAB/CMD1II/CRYA2 Lentiviral expression plasmid for CRYAB lentivirus packaging, CRYAB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CRYAB/CMD1II products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV000870 | Human CRYAB Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV000870 |
Gene Name | CRYAB |
Accession Number | NM_001885.2 |
Gene ID | 1410 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 528 bp |
Gene Alias | CMD1II,CRYA2,CTPP2,CTRCT16,HEL-S-101,HSPB5,MFM2 |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACATCGCCATCCACCACCCCTGGATCCGCCGCCCCTTCTTTCCTTTCCACTCCCCCAGCCGCCTCTTTGACCAGTTCTTCGGAGAGCACCTGTTGGAGTCTGATCTTTTCCCGACGTCTACTTCCCTGAGTCCCTTCTACCTTCGGCCACCCTCCTTCCTGCGGGCACCCAGCTGGTTTGACACTGGACTCTCAGAGATGCGCCTGGAGAAGGACAGGTTCTCTGTCAACCTGGATGTGAAGCACTTCTCCCCAGAGGAACTCAAAGTTAAGGTGTTGGGAGATGTGATTGAGGTGCATGGAAAACATGAAGAGCGCCAGGATGAACATGGTTTCATCTCCAGGGAGTTCCACAGGAAATACCGGATCCCAGCTGATGTAGACCCTCTCACCATTACTTCATCCCTGTCATCTGATGGGGTCCTCACTGTGAATGGACCAAGGAAACAGGTCTCTGGCCCTGAGCGCACCATTCCCATCACCCGTGAAGAGAAGCCTGCTGTCACCGCAGCCCCCAAGAAATAG |
ORF Protein Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0616-Ab | Anti-CRYAB monoclonal antibody |
Target Antigen | GM-Tg-g-IP0616-Ag | CRYAB protein |
ORF Viral Vector | pGMLP002745 | Human CRYAB Lentivirus plasmid |
ORF Viral Vector | pGMLV000870 | Human CRYAB Lentivirus plasmid |
ORF Viral Vector | pGMPC000454 | Human CRYAB Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC000968 | Human CRYAB Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002745 | Human CRYAB Lentivirus particle |
ORF Viral Vector | vGMLV000870 | Human CRYAB Lentivirus particle |
Target information
Target ID | GM-IP0616 |
Target Name | CRYAB |
Gene ID | 1410, 12955, 710747, 25420, 101092640, 479441, 281719, 100061921 |
Gene Symbol and Synonyms | AACRYA,CMD1II,Crya-2,CRYA2,CRYAB,CTPP2,CTRCT16,HEL-S-101,HSPB5,MFM2,P23 |
Uniprot Accession | P02511 |
Uniprot Entry Name | CRYAB_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000109846 |
Target Classification | Not Available |
Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2019]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.