Human IFITM2/1-8D/DSPA2c ORF/cDNA clone-Lentivirus particle (NM_006435)

Cat. No.: vGMLP002850

Pre-made Human IFITM2/1-8D/DSPA2c Lentiviral expression plasmid for IFITM2 lentivirus packaging, IFITM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFITM2/1-8D products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002850 Human IFITM2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002850
Gene Name IFITM2
Accession Number NM_006435
Gene ID 10581
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 399 bp
Gene Alias 1-8D,DSPA2c
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCACATTGTGCAAACCTTCTCTCCTGTCAACAGCGGCCAGCCTCCCAACTACGAGATGCTCAAGGAGGAGCAGGAAGTGGCTATGCTGGGGGTGCCCCACAACCCTGCTCCCCCGATGTCCACCGTGATCCACATCCGCAGCGAGACCTCCGTGCCTGACCATGTGGTCTGGTCCCTGTTCAACACCCTCTTCATGAACACCTGCTGCCTGGGCTTCATAGCATTCGCGTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTTTGGGCATCTTCATGACCATTCTGCTCATCATCATCCCAGTGTTGGTCGTCCAGGCCCAGCGATAG
ORF Protein Sequence MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0604-Ab Anti-IFM2/ IFITM2/ 1-8D monoclonal antibody
    Target Antigen GM-Tg-g-MP0604-Ag IFITM2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002850 Human IFITM2 Lentivirus plasmid
    ORF Viral Vector pGMLP003978 Human IFITM2 Lentivirus plasmid
    ORF Viral Vector vGMLP002850 Human IFITM2 Lentivirus particle
    ORF Viral Vector vGMLP003978 Human IFITM2 Lentivirus particle


    Target information

    Target ID GM-MP0604
    Target Name IFITM2
    Gene ID 10581
    Gene Symbol and Synonyms 1-8D,DSPA2c,IFITM2
    Uniprot Accession Q01629
    Uniprot Entry Name IFM2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000185201
    Target Classification Not Available

    Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2. [provided by RefSeq, Nov 2021]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.