Human SPINK1/PCTT/PSTI ORF/cDNA clone-Lentivirus particle (NM_003122)
Cat. No.: vGMLP002897
Pre-made Human SPINK1/PCTT/PSTI Lentiviral expression plasmid for SPINK1 lentivirus packaging, SPINK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SPINK1/PCTT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002897 | Human SPINK1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002897 |
| Gene Name | SPINK1 |
| Accession Number | NM_003122 |
| Gene ID | 6690 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 240 bp |
| Gene Alias | PCTT,PSTI,Spink3,TATI,TCP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGGTAACAGGCATCTTTCTTCTCAGTGCCTTGGCCCTGTTGAGTCTATCTGGTAACACTGGAGCTGACTCCCTGGGAAGAGAGGCCAAATGTTACAATGAACTTAATGGATGCACCAAGATATATGACCCTGTCTGTGGGACTGATGGAAATACTTATCCCAATGAATGCGTGTTATGTTTTGAAAATCGGAAACGCCAGACTTCTATCCTCATTCAAAAATCTGGGCCTTGCTGA |
| ORF Protein Sequence | MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1309-Ab | Anti-ISK1/ SPINK1/ PCTT functional antibody |
| Target Antigen | GM-Tg-g-SE1309-Ag | SPINK1 protein |
| ORF Viral Vector | pGMLP002897 | Human SPINK1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002897 | Human SPINK1 Lentivirus particle |
Target information
| Target ID | GM-SE1309 |
| Target Name | SPINK1 |
| Gene ID | 6690, 20730, 708951, 101085948, 608433, 574092, 100630883 |
| Gene Symbol and Synonyms | p12,PCTT,PSTI,SPINK1,Spink3,TATI,TCP |
| Uniprot Accession | P00995 |
| Uniprot Entry Name | ISK1_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Prostate Cancer |
| Gene Ensembl | ENSG00000164266 |
| Target Classification | Not Available |
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


