Human PAEP/GD/GdA ORF/cDNA clone-Lentivirus particle (NM_002571)

Cat. No.: vGMLP002959

Pre-made Human PAEP/GD/GdA Lentiviral expression plasmid for PAEP lentivirus packaging, PAEP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PAEP/GD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002959 Human PAEP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002959
Gene Name PAEP
Accession Number NM_002571
Gene ID 5047
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 543 bp
Gene Alias GD,GdA,GdF,GdS,PAEG,PEP,PP14,ZIF-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGTGCCTCCTGCTCACCCTGGGCGTGGCCCTGGTCTGTGGTGTCCCGGCCATGGACATCCCCCAGACCAAGCAGGACCTGGAGCTCCCAAAGTTGGCAGGGACCTGGCACTCCATGGCCATGGCGACCAACAACATCTCCCTCATGGCGACACTGAAGGCCCCTCTGAGGGTCCACATCACCTCACTGTTGCCCACCCCCGAGGACAACCTGGAGATCGTTCTGCACAGATGGGAGAACAACAGCTGTGTTGAGAAGAAGGTCCTTGGAGAGAAGACTGAGAATCCAAAGAAGTTCAAGATCAACTATACGGTGGCGAACGAGGCCACGCTGCTCGATACTGACTACGACAATTTCCTGTTTCTCTGCCTACAGGACACCACCACCCCCATCCAGAGCATGATGTGCCAGTACCTGGCCAGAGTCCTGGTGGAGGACGATGAGATCATGCAGGGATTCATCAGGGCTTTCAGGCCCCTGCCCAGGCACCTATGGTACTTGCTGGACTTGAAACAGATGGAAGAGCCGTGCCGTTTCTAG
ORF Protein Sequence MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1166-Ab Anti-PAEP/ GD/ GdA functional antibody
    Target Antigen GM-Tg-g-SE1166-Ag PAEP protein
    ORF Viral Vector pGMLP002959 Human PAEP Lentivirus plasmid
    ORF Viral Vector vGMLP002959 Human PAEP Lentivirus particle


    Target information

    Target ID GM-SE1166
    Target Name PAEP
    Gene ID 5047, 721853
    Gene Symbol and Synonyms GD,GdA,GdF,GdS,PAEG,PAEP,PEP,PP14,ZIF-1
    Uniprot Accession P09466
    Uniprot Entry Name PAEP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000122133
    Target Classification Tumor-associated antigen (TAA)

    This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.