Human ELOVL5/dJ483K16.1/HELO1 ORF/cDNA clone-Lentivirus particle (NM_021814)

Cat. No.: vGMLP003237

Pre-made Human ELOVL5/dJ483K16.1/HELO1 Lentiviral expression plasmid for ELOVL5 lentivirus packaging, ELOVL5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ELOVL5/dJ483K16.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003237 Human ELOVL5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003237
Gene Name ELOVL5
Accession Number NM_021814
Gene ID 60481
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 900 bp
Gene Alias dJ483K16.1,HELO1,SCA38
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAACATTTTGATGCATCACTTAGTACCTATTTCAAGGCATTGCTAGGCCCTCGAGATACTAGAGTAAAAGGATGGTTTCTTCTGGACAATTATATACCCACATTTATCTGCTCTGTCATATATTTACTAATTGTATGGCTGGGACCAAAATACATGAGGAATAAACAGCCATTCTCTTGCCGGGGGATTTTAGTGGTGTATAACCTTGGACTCACACTGCTGTCTCTGTATATGTTCTGTGAGTTAGTAACAGGAGTATGGGAAGGCAAATACAACTTCTTCTGTCAGGGCACACGCACCGCAGGAGAATCAGATATGAAGATTATCCGTGTCCTCTGGTGGTACTACTTCTCCAAACTCATAGAATTTATGGACACTTTCTTCTTCATCCTGCGCAAGAACAACCACCAGATCACGGTCCTGCACGTCTACCACCATGCCTCGATGCTGAACATCTGGTGGTTTGTGATGAACTGGGTCCCCTGCGGCCACTCTTATTTTGGTGCCACACTTAATAGCTTCATCCACGTCCTCATGTACTCTTACTATGGTTTGTCGTCAGTCCCTTCCATGCGTCCATACCTCTGGTGGAAGAAGTACATCACTCAGGGGCAGCTGCTTCAGTTTGTGCTGACAATCATCCAGACCAGCTGCGGGGTCATCTGGCCGTGCACATTCCCTCTTGGTTGGTTGTATTTCCAGATTGGATACATGATTTCCCTGATTGCTCTCTTCACAAACTTCTACATTCAGACCTACAACAAGAAAGGGGCCTCCCGAAGGAAAGACCACCTGAAGGACCACCAGAATGGGTCCATGGCTGCTGTGAATGGACACACCAACAGCTTTTCACCCCTGGAAAACAATGTGAAGCCAAGGAAGCTGCGGAAGGATTGA
ORF Protein Sequence MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0749-Ab Anti-ELOVL5 monoclonal antibody
    Target Antigen GM-Tg-g-IP0749-Ag ELOVL5 protein
    ORF Viral Vector pGMLP003237 Human ELOVL5 Lentivirus plasmid
    ORF Viral Vector vGMLP003237 Human ELOVL5 Lentivirus particle


    Target information

    Target ID GM-IP0749
    Target Name ELOVL5
    Gene ID 60481, 68801, 712243, 171400, 101086147, 610377, 617293, 100069400
    Gene Symbol and Synonyms 1110059L23Rik,dJ483K16.1,ELOVL5,HELO1,rELO1,SCA38
    Uniprot Accession Q9NYP7
    Uniprot Entry Name ELOV5_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000012660
    Target Classification Not Available

    This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.