Human RFLNB/CFM1/FAM101B ORF/cDNA clone-Lentivirus particle (NM_182705)

Cat. No.: vGMLP003454

Pre-made Human RFLNB/CFM1/FAM101B Lentiviral expression plasmid for RFLNB lentivirus packaging, RFLNB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RFLNB/CFM1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003454 Human RFLNB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003454
Gene Name RFLNB
Accession Number NM_182705
Gene ID 359845
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 645 bp
Gene Alias CFM1,FAM101B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGGCCGGCTGAGCCTACAGGATGTGCCCGAGCTCGTGGACGCGAAGAAGAAGGGCGACGGCGTCCTGGACAGCCCGGACTCGGGGCTGCCCCCCAGCCCCAGCCCCAGCCACTGGGGGCTCGCGGCGGGCGGAGGCGGCGGAGAGCGCGCGGCGGCACCGGGGACGCTGGAGCCCGACGCGGCGGCGGCGACCCCCGCGGCTCCGAGTCCAGCGTCTCTCCCCCTGGCTCCCGGCTGTGCGCTGAGGCTTTGTCCCCTGTCCTTTGGCGAAGGAGTGGAGTTTGACCCCTTACCACCAAAGGAAGTAAGGTACACCTCCTTGGTCAAGTACGACTCCGAGAGGCACTTCATCGACGACGTGCAGCTGCCCCTGGGCCTGGCGGTGGCCTCCTGCAGCCAGACGGTCACCTGTGTCCCCAATGGCACGTGGCGCAACTACAAGGCCGAGGTGCGCTTCGAGCCACGCCACAGGCCCACCCGCTTCCTCAGTACCACCATCGTGTACCCCAAGTACCCCAAGGCCGTCTACACCACCACCCTGGATTACAACTGCCGCAAGACGCTGAGGAGGTTTCTGTCCAGCGTGGAGCTCGAAGCCGCGGAGCTCCCGGGCAGCGACGACCTCTCTGATGAATGCTGA
ORF Protein Sequence MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEPDAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2697-Ab Anti-RFLNB monoclonal antibody
    Target Antigen GM-Tg-g-IP2697-Ag RFLNB protein
    ORF Viral Vector pGMLP003454 Human RFLNB Lentivirus plasmid
    ORF Viral Vector vGMLP003454 Human RFLNB Lentivirus particle


    Target information

    Target ID GM-IP2697
    Target Name RFLNB
    Gene ID 359845, 76566, 699332, 287534, 101087112, 611214, 112442617, 100072318
    Gene Symbol and Synonyms 1500005K14Rik,cfm,CFM1,FAM101B,RefilinB,RFLNB,RGD1359691
    Uniprot Accession Q8N5W9
    Uniprot Entry Name RFLB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000183688
    Target Classification Not Available

    Enables filamin binding activity. Predicted to be involved in several processes, including actin filament bundle organization; negative regulation of bone mineralization involved in bone maturation; and negative regulation of chondrocyte development. Predicted to act upstream of or within actin cytoskeleton organization and epithelial to mesenchymal transition. Predicted to be located in actin cytoskeleton. Predicted to be active in actin filament bundle. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.