Human LTB4R/BLT1/BLTR ORF/cDNA clone-Lentivirus particle (NM_181657)

Cat. No.: vGMLP003572

Pre-made Human LTB4R/BLT1/BLTR Lentiviral expression plasmid for LTB4R lentivirus packaging, LTB4R lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LTB4R/BLT1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003572 Human LTB4R Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003572
Gene Name LTB4R
Accession Number NM_181657
Gene ID 1241
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1059 bp
Gene Alias BLT1,BLTR,CMKRL1,GPR16,LTB4R1,LTBR1,P2RY7,P2Y7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACACTACATCTTCTGCAGCACCCCCCTCACTAGGTGTAGAGTTCATCTCTCTGCTGGCTATCATCCTGCTGTCAGTGGCGCTGGCTGTGGGGCTTCCCGGCAACAGCTTTGTGGTGTGGAGTATCCTGAAAAGGATGCAGAAGCGCTCTGTCACTGCCCTGATGGTGCTGAACCTGGCCCTGGCCGACCTGGCCGTATTGCTCACTGCTCCCTTTTTCCTTCACTTCCTGGCCCAAGGCACCTGGAGTTTTGGACTGGCTGGTTGCCGCCTGTGTCACTATGTCTGCGGAGTCAGCATGTACGCCAGCGTCCTGCTTATCACGGCCATGAGTCTAGACCGCTCACTGGCGGTGGCCCGCCCCTTTGTGTCCCAGAAGCTACGCACCAAGGCGATGGCCCGGCGGGTGCTGGCAGGCATCTGGGTGTTGTCCTTTCTGCTGGCCACACCCGTCCTCGCGTACCGCACAGTAGTGCCCTGGAAAACGAACATGAGCCTGTGCTTCCCGCGGTACCCCAGCGAAGGGCACCGGGCCTTCCATCTAATCTTCGAGGCTGTCACGGGCTTCCTGCTGCCCTTCCTGGCTGTGGTGGCCAGCTACTCGGACATAGGGCGTCGGCTACAGGCCCGGCGCTTCCGCCGCAGCCGCCGCACCGGCCGCCTGGTGGTGCTCATCATCCTGACCTTCGCCGCCTTCTGGCTGCCCTACCACGTGGTGAACCTGGCTGAGGCGGGCCGCGCGCTGGCCGGCCAGGCCGCCGGGTTAGGGCTCGTGGGGAAGCGGCTGAGCCTGGCCCGCAACGTGCTCATCGCACTCGCCTTCCTGAGCAGCAGCGTGAACCCCGTGCTGTACGCGTGCGCCGGCGGCGGCCTGCTGCGCTCGGCGGGCGTGGGCTTCGTCGCCAAGCTGCTGGAGGGCACGGGCTCCGAGGCGTCCAGCACGCGCCGCGGGGGCAGCCTGGGCCAGACCGCTAGGAGCGGCCCCGCCGCTCTGGAGCCCGGCCCTTCCGAGAGCCTCACTGCCTCCAGCCCTCTCAAGTTAAACGAACTGAACTAG
ORF Protein Sequence MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59626-Ab Anti-LT4R1/ LTB4R/ BLT1 monoclonal antibody
    Target Antigen GM-Tg-g-T59626-Ag LTB4R VLP (virus-like particle)
    ORF Viral Vector pGMLP003572 Human LTB4R Lentivirus plasmid
    ORF Viral Vector vGMLP003572 Human LTB4R Lentivirus particle


    Target information

    Target ID GM-T59626
    Target Name LTB4R
    Gene ID 1241, 16995, 716055, 59264, 101083519, 106559146, 613482, 102148203
    Gene Symbol and Synonyms BLT-1,BLT1,BLTR,CMKRL1,GPR16,LTB4-R1,LTB4R,LTB4R1,LTB4R2,LTBR1,mBLTR,P2RY7,P2Y7
    Uniprot Accession Q15722
    Uniprot Entry Name LT4R1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000213903
    Target Classification GPCR

    Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.