Human TPM1/C15orf13/CMD1Y ORF/cDNA clone-Lentivirus particle (NM_001018008)
Cat. No.: vGMLP003971
Pre-made Human TPM1/C15orf13/CMD1Y Lentiviral expression plasmid for TPM1 lentivirus packaging, TPM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TPM1/C15orf13 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003971 | Human TPM1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003971 |
| Gene Name | TPM1 |
| Accession Number | NM_001018008 |
| Gene ID | 7168 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 738 bp |
| Gene Alias | C15orf13,CMD1Y,CMH3,HEL-S-265,HTM-alpha,LVNC9,TMSA |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGGGAGTAGCTCGCTGGAGGCGGTGCGCAGGAAGATCCGGAGCCTGCAGGAGCAGGCGGACGCCGCTGAGGAGCGCGCGGGCACCCTGCAGCGCGAGCTGGACCACGAGAGGAAGCTGAGGGAGACCGCTGAAGCCGACGTAGCTTCTCTGAACAGACGCATCCAGCTGGTTGAGGAAGAGTTGGATCGTGCCCAGGAGCGTCTGGCAACAGCTTTGCAGAAGCTGGAGGAAGCTGAGAAGGCAGCAGATGAGAGTGAGAGAGGCATGAAAGTCATTGAGAGTCGAGCCCAAAAAGATGAAGAAAAAATGGAAATTCAGGAGATCCAACTGAAAGAGGCCAAGCACATTGCTGAAGATGCCGACCGCAAATATGAAGAGGTGGCCCGTAAGCTGGTCATCATTGAGAGCGACCTGGAACGTGCAGAGGAGCGGGCTGAGCTCTCAGAAGGCAAATGTGCCGAGCTTGAAGAAGAATTGAAAACTGTGACGAACAACTTGAAGTCACTGGAGGCTCAGGCTGAGAAGTACTCGCAGAAGGAAGACAGATATGAGGAAGAGATCAAGGTCCTTTCCGACAAGCTGAAGGAGGCTGAGACTCGGGCTGAGTTTGCGGAGAGGTCAGTAACTAAATTGGAGAAAAGCATTGATGACTTAGAAGATCAACTCTACCAGCAACTTGAGCAAAATCGCCGCCTCACTAATGAACTAAAGCTGGCCCTGAATGAGGATTAA |
| ORF Protein Sequence | MAGSSSLEAVRRKIRSLQEQADAAEERAGTLQRELDHERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2167-Ab | Anti-TPM1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2167-Ag | TPM1 protein |
| ORF Viral Vector | pGMLP003971 | Human TPM1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003971 | Human TPM1 Lentivirus particle |
Target information
| Target ID | GM-IP2167 |
| Target Name | TPM1 |
| Gene ID | 7168, 22003, 705236, 24851, 101091450, 478332, 281544, 100067330 |
| Gene Symbol and Synonyms | alpha-TM,C15orf13,CMD1Y,CMH3,HEL-S-265,HTM-alpha,LVNC9,TM2,Tm3,Tma2,Tmpa,TMSA,Tpm-1,TPM1,TPM1kappa |
| Uniprot Accession | P09493 |
| Uniprot Entry Name | TPM1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Obstructive sleep apnea (adult) (pediatric) |
| Gene Ensembl | ENSG00000140416 |
| Target Classification | Not Available |
This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy and dilated cardiomyopathy 1Y. [provided by RefSeq, Jun 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


