Human LYZL1/bA534G20.1/KAAG648 ORF/cDNA clone-Lentivirus particle (NM_032517.4)

Cat. No.: vGMLP003980

Pre-made Human LYZL1/bA534G20.1/KAAG648 Lentiviral expression plasmid for LYZL1 lentivirus packaging, LYZL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LYZL1/bA534G20.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003980 Human LYZL1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003980
Gene Name LYZL1
Accession Number NM_032517.4
Gene ID 84569
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 585 bp
Gene Alias bA534G20.1,KAAG648,LYC2,LYZD1,PRO1278
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGACGCTCCCCTGAGCTGCCTGTCACCGACTAAGTGGAGCAGTGTTTCTTCCGCAGACTCAACTGAGAAGTCAGCCTCTGGGGCAGGCACCAGGAATCTGCCTTTTCAGTTCTGTCTCCGGCAGGCTTTGAGGATGAAGGCTGCGGGCATTCTGACCCTCATTGGCTGCCTGGTCACAGGCGCCGAGTCCAAAATCTACACTCGTTGCAAACTGGCAAAAATATTCTCGAGGGCTGGCCTGGACAATTACTGGGGCTTCAGCCTTGGAAACTGGATCTGCATGGCATATTATGAGAGCGGCTACAACACCACAGCCCAGACGGTCCTGGATGACGGCAGCATCGACTATGGCATCTTCCAGATCAACAGCTTCGCGTGGTGCAGACGCGGAAAGCTGAAGGAGAACAACCACTGCCATGTCGCCTGCTCAGCCTTGATCACTGATGACCTCACAGATGCAATTATCTGTGCCAGGAAAATTGTTAAAGAGACACAAGGAATGAACTATTGGCAAGGCTGGAAGAAACATTGTGAGGGCAGAGACCTGTCCGAGTGGAAAAAAGGCTGTGAGGTTTCCTAA
ORF Protein Sequence MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0332-Ab Anti-LYZL1/ KAAG648/ LYC2 functional antibody
    Target Antigen GM-Tg-g-SE0332-Ag LYZL1 protein
    ORF Viral Vector pGMLP003980 Human LYZL1 Lentivirus plasmid
    ORF Viral Vector vGMLP003980 Human LYZL1 Lentivirus particle


    Target information

    Target ID GM-SE0332
    Target Name LYZL1
    Gene ID 84569, 100055156
    Gene Symbol and Synonyms bA534G20.1,KAAG648,LYC2,LYZD1,LYZL1,PRO1278
    Uniprot Accession Q6UWQ5
    Uniprot Entry Name LYZL1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000120563
    Target Classification Not Available

    Predicted to enable lysozyme activity. Predicted to be located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.