Human CLDN4/CPE-R/CPER ORF/cDNA clone-Lentivirus particle (NM_001305.4)

Cat. No.: vGMLP003984

Pre-made Human CLDN4/CPE-R/CPER Lentiviral expression plasmid for CLDN4 lentivirus packaging, CLDN4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CLDN4/CPE-R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003984 Human CLDN4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003984
Gene Name CLDN4
Accession Number NM_001305.4
Gene ID 1364
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 630 bp
Gene Alias CPE-R,CPER,CPETR,CPETR1,hCPE-R,WBSCR8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCCATGGGGCTACAGGTAATGGGCATCGCGCTGGCCGTCCTGGGCTGGCTGGCCGTCATGCTGTGCTGCGCGCTGCCCATGTGGCGCGTGACGGCCTTCATCGGCAGCAACATTGTCACCTCGCAGACCATCTGGGAGGGCCTATGGATGAACTGCGTGGTGCAGAGCACCGGCCAGATGCAGTGCAAGGTGTACGACTCGCTGCTGGCACTGCCGCAGGACCTGCAGGCGGCCCGCGCCCTCGTCATCATCAGCATCATCGTGGCTGCTCTGGGCGTGCTGCTGTCCGTGGTGGGGGGCAAGTGTACCAACTGCCTGGAGGATGAAAGCGCCAAGGCCAAGACCATGATCGTGGCGGGCGTGGTGTTCCTGTTGGCCGGCCTTATGGTGATAGTGCCGGTGTCCTGGACGGCCCACAACATCATCCAAGACTTCTACAATCCGCTGGTGGCCTCCGGGCAGAAGCGGGAGATGGGTGCCTCGCTCTACGTCGGCTGGGCCGCCTCCGGCCTGCTGCTCCTTGGCGGGGGGCTGCTTTGCTGCAACTGTCCACCCCGCACAGACAAGCCTTACTCCGCCAAGTATTCTGCTGCCCGCTCTGCTGCTGCCAGCAACTACGTGTAA
ORF Protein Sequence MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T51270-Ab Anti-CLD4/ CLDN4/ CPE-R monoclonal antibody
    Target Antigen GM-Tg-g-T51270-Ag CLDN4 VLP (virus-like particle)
    ORF Viral Vector pGMLP000452 Human CLDN4 Lentivirus plasmid
    ORF Viral Vector pGMLP003984 Human CLDN4 Lentivirus plasmid
    ORF Viral Vector vGMLP000452 Human CLDN4 Lentivirus particle
    ORF Viral Vector vGMLP003984 Human CLDN4 Lentivirus particle


    Target information

    Target ID GM-T51270
    Target Name CLDN4
    Gene ID 1364, 12740, 716808, 304407, 101093412, 100856416, 414921, 100059948
    Gene Symbol and Synonyms Cep-r,claudin-4,CLDN4,CPE-R,CPER,CPETR,CPETR1,hCPE-R,WBSCR8
    Uniprot Accession O14493
    Uniprot Entry Name CLD4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease ovarian cancer
    Gene Ensembl ENSG00000189143
    Target Classification Not Available

    The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.