Human RNASE4/RAB1/RNS4 ORF/cDNA clone-Lentivirus particle (NM_194431)

Cat. No.: vGMLP004155

Pre-made Human RNASE4/RAB1/RNS4 Lentiviral expression plasmid for RNASE4 lentivirus packaging, RNASE4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RNASE4/RAB1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004155 Human RNASE4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004155
Gene Name RNASE4
Accession Number NM_194431
Gene ID 6038
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 444 bp
Gene Alias RAB1,RNS4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCTGCAGAGGACCCATTCATTGCTTCTGCTTTTGCTGCTGACCCTGCTGGGGCTGGGGCTGGTCCAGCCCTCCTATGGCCAGGATGGCATGTACCAGCGATTCCTGCGGCAACACGTGCACCCTGAGGAGACAGGTGGCAGTGATCGCTACTGCAACTTGATGATGCAAAGACGGAAGATGACTTTGTATCACTGCAAGCGCTTCAACACCTTCATCCATGAAGATATCTGGAACATTCGTAGTATCTGCAGCACCACCAATATCCAATGCAAGAACGGCAAGATGAACTGCCATGAGGGTGTAGTGAAGGTCACAGATTGCAGGGACACAGGAAGTTCCAGGGCACCCAACTGCAGATATCGGGCCATAGCGAGCACTAGACGTGTTGTCATTGCCTGTGAGGGTAACCCACAGGTGCCTGTGCACTTTGACGGTTAG
ORF Protein Sequence MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0448-Ab Anti-RNAS4/ RNASE4/ RAB1 functional antibody
    Target Antigen GM-Tg-g-SE0448-Ag RNASE4 protein
    ORF Viral Vector pGMLP004155 Human RNASE4 Lentivirus plasmid
    ORF Viral Vector vGMLP004155 Human RNASE4 Lentivirus particle


    Target information

    Target ID GM-SE0448
    Target Name RNASE4
    Gene ID 6038, 58809, 56759, 102900763, 616089, 106780845
    Gene Symbol and Synonyms C730049F20Rik,RAB1,RNASE4,RNS4
    Uniprot Accession P34096
    Uniprot Entry Name RNAS4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000258818
    Target Classification Not Available

    The protein encoded by this gene belongs to the pancreatic ribonuclease family. It plays an important role in mRNA cleavage and has marked specificity towards the 3' side of uridine nucleotides. Alternative splicing results in four transcript variants encoding the same protein. This gene and the gene that encodes angiogenin share promoters and 5' exons. Each gene splices to a unique downstream exon that contains its complete coding region. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.