Human PI3/cementoin/ESI ORF/cDNA clone-Lentivirus particle (NM_002638)
Cat. No.: vGMLP004215
Pre-made Human PI3/cementoin/ESI Lentiviral expression plasmid for PI3 lentivirus packaging, PI3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PI3/cementoin products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004215 | Human PI3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004215 |
| Gene Name | PI3 |
| Accession Number | NM_002638 |
| Gene ID | 5266 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 354 bp |
| Gene Alias | cementoin,ESI,SKALP,WAP3,WFDC14 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGGCCAGCAGCTTCTTGATCGTGGTGGTGTTCCTCATCGCTGGGACGCTGGTTCTAGAGGCAGCTGTCACGGGAGTTCCTGTTAAAGGTCAAGACACTGTCAAAGGCCGTGTTCCATTCAATGGACAAGATCCCGTTAAAGGACAAGTTTCAGTTAAAGGTCAAGATAAAGTCAAAGCGCAAGAGCCAGTCAAAGGTCCAGTCTCCACTAAGCCTGGCTCCTGCCCCATTATCTTGATCCGGTGCGCCATGTTGAATCCCCCTAACCGCTGCTTGAAAGATACTGACTGCCCAGGAATCAAGAAGTGCTGTGAAGGCTCTTGCGGGATGGCCTGTTTCGTTCCCCAGTGA |
| ORF Protein Sequence | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0406-Ab | Anti-ELAF/ PI3/ ESI functional antibody |
| Target Antigen | GM-Tg-g-SE0406-Ag | PI3 protein |
| ORF Viral Vector | pGMLP004215 | Human PI3 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000494 | Human PI3 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLP004215 | Human PI3 Lentivirus particle |
| ORF Viral Vector | vGMAAV000494 | Human PI3 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-SE0406 |
| Target Name | PI3 |
| Gene ID | 5266, 574237, 101090932, 477241, 100056125 |
| Gene Symbol and Synonyms | cementoin,ESI,PI3,SKALP,TRAPPIN-2,WAP3,WFDC14 |
| Uniprot Accession | P19957 |
| Uniprot Entry Name | ELAF_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Ovary Cancer |
| Gene Ensembl | ENSG00000124102 |
| Target Classification | Not Available |
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


