Human PI3/cementoin/ESI ORF/cDNA clone-Lentivirus particle (NM_002638)

Cat. No.: vGMLP004215

Pre-made Human PI3/cementoin/ESI Lentiviral expression plasmid for PI3 lentivirus packaging, PI3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PI3/cementoin products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004215 Human PI3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004215
Gene Name PI3
Accession Number NM_002638
Gene ID 5266
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 354 bp
Gene Alias cementoin,ESI,SKALP,WAP3,WFDC14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGCCAGCAGCTTCTTGATCGTGGTGGTGTTCCTCATCGCTGGGACGCTGGTTCTAGAGGCAGCTGTCACGGGAGTTCCTGTTAAAGGTCAAGACACTGTCAAAGGCCGTGTTCCATTCAATGGACAAGATCCCGTTAAAGGACAAGTTTCAGTTAAAGGTCAAGATAAAGTCAAAGCGCAAGAGCCAGTCAAAGGTCCAGTCTCCACTAAGCCTGGCTCCTGCCCCATTATCTTGATCCGGTGCGCCATGTTGAATCCCCCTAACCGCTGCTTGAAAGATACTGACTGCCCAGGAATCAAGAAGTGCTGTGAAGGCTCTTGCGGGATGGCCTGTTTCGTTCCCCAGTGA
ORF Protein Sequence MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0406-Ab Anti-ELAF/ PI3/ ESI functional antibody
    Target Antigen GM-Tg-g-SE0406-Ag PI3 protein
    ORF Viral Vector pGMLP004215 Human PI3 Lentivirus plasmid
    ORF Viral Vector pGMAAV000494 Human PI3 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004215 Human PI3 Lentivirus particle
    ORF Viral Vector vGMAAV000494 Human PI3 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0406
    Target Name PI3
    Gene ID 5266, 574237, 101090932, 477241, 100056125
    Gene Symbol and Synonyms cementoin,ESI,PI3,SKALP,TRAPPIN-2,WAP3,WFDC14
    Uniprot Accession P19957
    Uniprot Entry Name ELAF_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000124102
    Target Classification Not Available

    This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.