Human NDUFA4/CI-9k/CI-MLRQ ORF/cDNA clone-Lentivirus particle (NM_002489)

Cat. No.: vGMLP004389

Pre-made Human NDUFA4/CI-9k/CI-MLRQ Lentiviral expression plasmid for NDUFA4 lentivirus packaging, NDUFA4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NDUFA4/CI-9k products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004389 Human NDUFA4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004389
Gene Name NDUFA4
Accession Number NM_002489
Gene ID 4697
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 246 bp
Gene Alias CI-9k,CI-MLRQ,MLRQ
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCGCCAGATCATCGGTCAGGCCAAGAAGCATCCGAGCTTGATCCCCCTCTTTGTATTTATTGGAACTGGAGCTACTGGAGCAACACTGTATCTCTTGCGTCTGGCATTGTTCAATCCAGATGTTTGTTGGGACAGAAATAACCCAGAGCCCTGGAACAAACTGGGTCCCAATGATCAATACAAGTTCTACTCAGTGAATGTGGATTACAGCAAGCTGAAGAAGGAACGTCCAGATTTCTAA
ORF Protein Sequence MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1255-Ab Anti-NDUFA4 monoclonal antibody
    Target Antigen GM-Tg-g-IP1255-Ag NDUFA4 protein
    ORF Viral Vector pGMLP004389 Human NDUFA4 Lentivirus plasmid
    ORF Viral Vector pGMLV001297 Human NDUFA4 Lentivirus plasmid
    ORF Viral Vector vGMLP004389 Human NDUFA4 Lentivirus particle
    ORF Viral Vector vGMLV001297 Human NDUFA4 Lentivirus particle


    Target information

    Target ID GM-IP1255
    Target Name NDUFA4
    Gene ID 4697, 17992, 641333, 681024, 101099952, 100856334, 327704, 106783042
    Gene Symbol and Synonyms CI-9k,CI-MLRQ,COXFA4,MC4DN21,MISTR1,MLRQ,MRCAF1,NDUFA4
    Uniprot Accession O00483
    Uniprot Entry Name NDUA4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000189043
    Target Classification Not Available

    The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.