Human NDUFA4/CI-9k/CI-MLRQ ORF/cDNA clone-Lentivirus particle (NM_002489)
Cat. No.: vGMLV001297
Pre-made Human NDUFA4/CI-9k/CI-MLRQ Lentiviral expression plasmid for NDUFA4 lentivirus packaging, NDUFA4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NDUFA4/CI-9k products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV001297 | Human NDUFA4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV001297 |
Gene Name | NDUFA4 |
Accession Number | NM_002489 |
Gene ID | 4697 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 246 bp |
Gene Alias | CI-9k,CI-MLRQ,COXFA4,MC4DN21,MLRQ |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTCCGCCAGATCATCGGTCAGGCCAAGAAGCATCCGAGCTTGATCCCCCTCTTTGTATTTATTGGAACTGGAGCTACTGGAGCAACACTGTATCTCTTGCGTCTGGCATTGTTCAATCCAGATGTTTGTTGGGACAGAAATAACCCAGAGCCCTGGAACAAACTGGGTCCCAATGATCAATACAAGTTCTACTCAGTGAATGTGGATTACAGCAAGCTGAAGAAGGAACGTCCAGATTTCTAA |
ORF Protein Sequence | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1255-Ab | Anti-NDUFA4 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1255-Ag | NDUFA4 protein |
ORF Viral Vector | pGMLP004389 | Human NDUFA4 Lentivirus plasmid |
ORF Viral Vector | pGMLV001297 | Human NDUFA4 Lentivirus plasmid |
ORF Viral Vector | vGMLP004389 | Human NDUFA4 Lentivirus particle |
ORF Viral Vector | vGMLV001297 | Human NDUFA4 Lentivirus particle |
Target information
Target ID | GM-IP1255 |
Target Name | NDUFA4 |
Gene ID | 4697, 17992, 641333, 681024, 101099952, 100856334, 327704, 106783042 |
Gene Symbol and Synonyms | CI-9k,CI-MLRQ,COXFA4,MC4DN21,MISTR1,MLRQ,MRCAF1,NDUFA4 |
Uniprot Accession | O00483 |
Uniprot Entry Name | NDUA4_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000189043 |
Target Classification | Not Available |
The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.