Human SIT1/SIT/SIT-R ORF/cDNA clone-Lentivirus particle (NM_014450)

Cat. No.: vGMLP004401

Pre-made Human SIT1/SIT/SIT-R Lentiviral expression plasmid for SIT1 lentivirus packaging, SIT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SIT1/SIT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004401 Human SIT1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004401
Gene Name SIT1
Accession Number NM_014450
Gene ID 27240
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 591 bp
Gene Alias SIT,SIT-R
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCAGGCTGACCCTCGGCTCAGAGCAGTGTGCTTGTGGACTCTCACATCTGCAGCCATGAGCAGAGGCGACAACTGCACGGATCTACTCGCACTGGGAATCCCCTCCATAACCCAGGCCTGGGGACTGTGGGTCCTCTTAGGGGCTGTGACGCTGCTATTTCTCATCTCGCTGGCTGCACACTTGTCCCAGTGGACCAGGGGCCGGAGCAGGAGCCATCCGGGGCAGGGACGCTCTGGAGAGTCTGTGGAAGAGGTCCCGCTGTATGGGAACCTGCATTATCTACAGACAGGACGGCTGTCTCAAGACCCAGAGCCAGACCAGCAGGATCCAACTCTTGGAGGCCCTGCCAGGGCTGCAGAGGAGGTGATGTGCTATACCAGCCTGCAGCTGCGGCCTCCTCAGGGTCGGATCCCCGGTCCTGGAACCCCCGTCAAGTACTCGGAGGTGGTGCTGGACTCTGAGCCAAAGTCCCAGGCCTCGGGCCCCGAGCCGGAGCTCTATGCCTCAGTATGTGCCCAGACCCGCAGGGCCCGGGCCTCCTTCCCGGATCAGGCCTATGCCAACAGCCAGCCTGCAGCCAGCTGA
ORF Protein Sequence MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1530-Ab Anti-SIT1/ SIT/ SIT-R monoclonal antibody
    Target Antigen GM-Tg-g-MP1530-Ag SIT1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004401 Human SIT1 Lentivirus plasmid
    ORF Viral Vector vGMLP004401 Human SIT1 Lentivirus particle


    Target information

    Target ID GM-MP1530
    Target Name SIT1
    Gene ID 27240, 54390, 697087, 500449, 101087016, 611919, 512027, 100067968
    Gene Symbol and Synonyms SIT,SIT-R,SIT1
    Uniprot Accession Q9Y3P8
    Uniprot Entry Name SIT1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000137078
    Target Classification Not Available

    Enables kinase binding activity. Involved in regulation of T cell activation. Located in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.