Human LCN1/PMFA/TLC ORF/cDNA clone-Lentivirus particle (NM_002297)

Cat. No.: vGMLP004494

Pre-made Human LCN1/PMFA/TLC Lentiviral expression plasmid for LCN1 lentivirus packaging, LCN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LCN1/PMFA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004494 Human LCN1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004494
Gene Name LCN1
Accession Number NM_002297
Gene ID 3933
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 531 bp
Gene Alias PMFA,TLC,TP,VEGP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCCCCTGCTCCTGGCCGTCAGCCTTGGCCTCATTGCTGCCCTGCAGGCCCACCACCTCCTGGCCTCAGACGAGGAGATTCAGGATGTGTCAGGGACGTGGTATCTGAAGGCCATGACGGTGGACAGGGAGTTCCCTGAGATGAATCTGGAATCGGTGACACCCATGACCCTCACGACCCTGGAAGGGGGCAACCTGGAAGCCAAGGTCACCATGCTGATAAGTGGCCGGTGCCAGGAGGTGAAGGCCGTCCTGGAGAAAACTGACGAGCCGGGAAAATACACGGCCGACGGGGGCAAGCACGTGGCATACATCATCAGGTCGCACGTGAAGGACCACTACATCTTTTACTGTGAGGGCGAGCTGCACGGGAAGCCGGTCCGAGGGGTGAAGCTCGTGGGCAGAGACCCCAAGAACAACCTGGAAGCCTTGGAGGACTTTGAGAAAGCCGCAGGAGCCCGCGGACTCAGCACGGAGAGCATCCTCATCCCCAGGCAGAGCGAAACCTGCTCTCCAGGGAGCGATTAG
ORF Protein Sequence MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1059-Ab Anti-LCN1/ PMFA/ TLC functional antibody
    Target Antigen GM-Tg-g-SE1059-Ag LCN1 protein
    ORF Viral Vector pGMLP004494 Human LCN1 Lentivirus plasmid
    ORF Viral Vector vGMLP004494 Human LCN1 Lentivirus particle


    Target information

    Target ID GM-SE1059
    Target Name LCN1
    Gene ID 3933, 711974, 511158
    Gene Symbol and Synonyms LCN1,PMFA,TLC,TP,VEGP
    Uniprot Accession P31025
    Uniprot Entry Name LCN1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160349
    Target Classification Not Available

    This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overproduced in response to multiple stimuli including infection and stress. The encoded protein may be a marker for chromosome aneuploidy as well as an autoantigen in Sjogren's syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and two pseudogenes of this gene are also located on the long arm of chromosome 9. [provided by RefSeq, Nov 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.