Human RAMP2 ORF/cDNA clone-Lentivirus particle (NM_005854)

Cat. No.: vGMLP004515

Pre-made Human RAMP2/ Lentiviral expression plasmid for RAMP2 lentivirus packaging, RAMP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RAMP2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004515 Human RAMP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004515
Gene Name RAMP2
Accession Number NM_005854
Gene ID 10266
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 528 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCGCTCCGGGTGGAGCGCGCCGGCGGCCCGCGTCTCCCTAGGACCCGAGTCGGGCGGCCGGCAGCGCTCCGCCTCCTCCTCCTGCTGGGCGCTGTCCTGAATCCCCACGAGGCCCTGGCTCAGCCTCTTCCCACCACAGGCACACCAGGGTCAGAAGGGGGGACGGTGAAGAACTATGAGACAGCTGTCCAATTTTGCTGGAATCATTATAAGGATCAAATGGATCCTATCGAAAAGGATTGGTGCGACTGGGCCATGATTAGCAGGCCTTATAGCACCCTGCGAGATTGCCTGGAGCACTTTGCAGAGTTGTTTGACCTGGGCTTCCCCAATCCCTTGGCAGAGAGGATCATCTTTGAGACTCACCAGATCCACTTTGCCAACTGCTCCCTGGTGCAGCCCACCTTCTCTGACCCCCCAGAGGATGTACTCCTGGCCATGATCATAGCCCCCATCTGCCTCATCCCCTTCCTCATCACTCTTGTAGTATGGAGGAGTAAAGACAGTGAGGCCCAGGCCTAG
ORF Protein Sequence MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1452-Ab Anti-RAMP2 monoclonal antibody
    Target Antigen GM-Tg-g-MP1452-Ag RAMP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004515 Human RAMP2 Lentivirus plasmid
    ORF Viral Vector vGMLP004515 Human RAMP2 Lentivirus particle


    Target information

    Target ID GM-MP1452
    Target Name RAMP2
    Gene ID 10266, 54409, 707718, 58966, 101092654, 480515, 504230, 100630685
    Gene Symbol and Synonyms RAMP2
    Uniprot Accession O60895
    Uniprot Entry Name RAMP2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000131477
    Target Classification Not Available

    The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.