Human CD53/MOX44/TSPAN25 ORF/cDNA clone-Lentivirus particle (NM_000560)

Cat. No.: vGMLP004539

Pre-made Human CD53/MOX44/TSPAN25 Lentiviral expression plasmid for CD53 lentivirus packaging, CD53 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD53/MOX44 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004539 Human CD53 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004539
Gene Name CD53
Accession Number NM_000560
Gene ID 963
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 660 bp
Gene Alias MOX44,TSPAN25
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCATGAGTAGCTTGAAACTGCTGAAGTATGTCCTGTTTTTCTTCAACTTGCTCTTTTGGATCTGTGGCTGCTGCATTTTGGGCTTTGGGATCTACCTGCTGATCCACAACAACTTCGGAGTGCTCTTCCATAACCTCCCCTCCCTCACGCTGGGCAATGTGTTTGTCATCGTGGGCTCTATTATCATGGTAGTTGCCTTCCTGGGCTGCATGGGCTCTATCAAGGAAAACAAGTGTCTGCTTATGTCGTTCTTCATCCTGCTGCTGATTATCCTCCTTGCTGAGGTGACCTTGGCCATCCTGCTCTTTGTATATGAACAGAAGCTGAATGAGTATGTGGCTAAGGGTCTGACCGACAGCATCCACCGTTACCACTCAGACAATAGCACCAAGGCAGCGTGGGACTCCATCCAGTCATTTCTGCAGTGTTGTGGTATAAATGGCACGAGTGATTGGACCAGTGGCCCACCAGCATCTTGCCCCTCAGATCGAAAAGTGGAGGGTTGCTATGCGAAAGCAAGACTGTGGTTTCATTCCAATTTCCTGTATATCGGAATCATCACCATCTGTGTATGTGTGATTGAGGTGTTGGGGATGTCCTTTGCACTGACCCTGAACTGCCAGATTGACAAAACCAGCCAGACCATAGGGCTATGA
ORF Protein Sequence MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0213-Ab Anti-CD53/ MOX44/ TSPAN25 monoclonal antibody
    Target Antigen GM-Tg-g-MP0213-Ag CD53 VLP (virus-like particle)
    ORF Viral Vector pGMLP004539 Human CD53 Lentivirus plasmid
    ORF Viral Vector vGMLP004539 Human CD53 Lentivirus particle


    Target information

    Target ID GM-MP0213
    Target Name CD53
    Gene ID 963, 12508, 702350, 24251, 101084381, 100855953, 505040, 100058745
    Gene Symbol and Synonyms CD53,MOX44,Ox-44,OX44,TSPAN25
    Uniprot Accession P19397
    Uniprot Entry Name CD53_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143119
    Target Classification Not Available

    The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.