Human INSIG1/CL6 ORF/cDNA clone-Lentivirus particle (NM_005542)
Cat. No.: vGMLP004574
Pre-made Human INSIG1/CL6 Lentiviral expression plasmid for INSIG1 lentivirus packaging, INSIG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
INSIG1/CL6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004574 | Human INSIG1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004574 |
Gene Name | INSIG1 |
Accession Number | NM_005542 |
Gene ID | 3638 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 834 bp |
Gene Alias | CL6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCCAGATTGCACGACCACTTCTGGAGCTGCTCCTGTGCGCACAGCGCGAGGCGCCGAGGCCCCCCGCGAGCCAGCGCCGCGGGGCTGGCGGCCAAGGTTGGGGAGATGATCAACGTTTCCGTGTCCGGGCCCTCCCTGCTGGCGGCCCACGGTGCCCCGGACGCTGACCCCGCGCCCAGGGGCCGCAGTGCTGCGATGAGCGGCCCCGAGCCCGGCAGCCCCTACCCCAACACCTGGCATCATCGCCTGTTGCAGAGGAGCCTCGTGCTCTTCTCGGTTGGGGTGGTCCTAGCCCTGGTGCTCAACCTGCTGCAGATCCAGAGGAATGTCACTCTCTTCCCCGAGGAGGTGATCGCCACCATCTTTTCCTCCGCCTGGTGGGTCCCTCCCTGCTGCGGGACAGCAGCTGCTGTTGTTGGCCTACTGTACCCCTGTATCGACAGTCACCTCGGAGAACCCCACAAATTTAAGAGAGAATGGGCCAGTGTCATGCGCTGCATAGCAGTTTTTGTTGGCATTAACCACGCCAGTGCTAAATTGGATTTTGCCAATAATGTCCAGCTGTCCTTGACTTTAGCAGCCCTATCTTTGGGCCTTTGGTGGACATTTGATCGTTCCAGAAGTGGCCTTGGGCTGGGGATCACCATAGCTTTTCTAGCTACGCTGATCACGCAGTTTCTCGTGTATAATGGTGTCTATCAGTATACATCCCCAGATTTCCTCTATATTCGTTCTTGGCTCCCTTGTATATTTTTCTCAGGAGGCGTCACGGTGGGGAACATAGGACGACAGTTAGCTATGGGTGTTCCTGAAAAGCCCCATAGTGATTGA |
ORF Protein Sequence | MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1014-Ab | Anti-INSIG1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1014-Ag | INSIG1 protein |
ORF Viral Vector | pGMLP004574 | Human INSIG1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004574 | Human INSIG1 Lentivirus particle |
Target information
Target ID | GM-IP1014 |
Target Name | INSIG1 |
Gene ID | 3638, 231070, 718513, 64194, 101087651, 475554, 511899, 100065774 |
Gene Symbol and Synonyms | 1810013C12Rik,CL6,Insig-1,INSIG1 |
Uniprot Accession | O15503 |
Uniprot Entry Name | INSI1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000186480 |
Target Classification | Not Available |
This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.