Human INSIG1/CL6 ORF/cDNA clone-Lentivirus particle (NM_005542)

Cat. No.: vGMLP004574

Pre-made Human INSIG1/CL6 Lentiviral expression plasmid for INSIG1 lentivirus packaging, INSIG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to INSIG1/CL6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004574 Human INSIG1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004574
Gene Name INSIG1
Accession Number NM_005542
Gene ID 3638
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 834 bp
Gene Alias CL6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCAGATTGCACGACCACTTCTGGAGCTGCTCCTGTGCGCACAGCGCGAGGCGCCGAGGCCCCCCGCGAGCCAGCGCCGCGGGGCTGGCGGCCAAGGTTGGGGAGATGATCAACGTTTCCGTGTCCGGGCCCTCCCTGCTGGCGGCCCACGGTGCCCCGGACGCTGACCCCGCGCCCAGGGGCCGCAGTGCTGCGATGAGCGGCCCCGAGCCCGGCAGCCCCTACCCCAACACCTGGCATCATCGCCTGTTGCAGAGGAGCCTCGTGCTCTTCTCGGTTGGGGTGGTCCTAGCCCTGGTGCTCAACCTGCTGCAGATCCAGAGGAATGTCACTCTCTTCCCCGAGGAGGTGATCGCCACCATCTTTTCCTCCGCCTGGTGGGTCCCTCCCTGCTGCGGGACAGCAGCTGCTGTTGTTGGCCTACTGTACCCCTGTATCGACAGTCACCTCGGAGAACCCCACAAATTTAAGAGAGAATGGGCCAGTGTCATGCGCTGCATAGCAGTTTTTGTTGGCATTAACCACGCCAGTGCTAAATTGGATTTTGCCAATAATGTCCAGCTGTCCTTGACTTTAGCAGCCCTATCTTTGGGCCTTTGGTGGACATTTGATCGTTCCAGAAGTGGCCTTGGGCTGGGGATCACCATAGCTTTTCTAGCTACGCTGATCACGCAGTTTCTCGTGTATAATGGTGTCTATCAGTATACATCCCCAGATTTCCTCTATATTCGTTCTTGGCTCCCTTGTATATTTTTCTCAGGAGGCGTCACGGTGGGGAACATAGGACGACAGTTAGCTATGGGTGTTCCTGAAAAGCCCCATAGTGATTGA
ORF Protein Sequence MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1014-Ab Anti-INSIG1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1014-Ag INSIG1 protein
    ORF Viral Vector pGMLP004574 Human INSIG1 Lentivirus plasmid
    ORF Viral Vector vGMLP004574 Human INSIG1 Lentivirus particle


    Target information

    Target ID GM-IP1014
    Target Name INSIG1
    Gene ID 3638, 231070, 718513, 64194, 101087651, 475554, 511899, 100065774
    Gene Symbol and Synonyms 1810013C12Rik,CL6,Insig-1,INSIG1
    Uniprot Accession O15503
    Uniprot Entry Name INSI1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000186480
    Target Classification Not Available

    This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.