Human IFI35/IFP35 ORF/cDNA clone-Lentivirus particle (NM_005533)

Cat. No.: vGMLP004640

Pre-made Human IFI35/IFP35 Lentiviral expression plasmid for IFI35 lentivirus packaging, IFI35 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFI35/IFP35 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004640 Human IFI35 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004640
Gene Name IFI35
Accession Number NM_005533
Gene ID 3430
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 867 bp
Gene Alias IFP35
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAGCCCCACTGGATGCCGCCCTCCACGCCCTTCAGGAGGAGCAGGCCAGACTCAAGATGAGGCTGTGGGACCTGCAGCAGCTGAGAAAGGAGCTCGGGGACTCCCCCAAAGACAAGGTCCCATTTTCAGTGCCCAAGATCCCCCTGGTATTCCGAGGACACACCCAGCAGGACCCGGAAGTGCCTAAGTCTTTAGTTTCCAATTTGCGGATCCACTGCCCTCTGCTTGCGGGCTCTGCTCTGATCACCTTTGATGACCCCAAAGTGGCTGAGCAGGTGCTGCAACAAAAGGAGCACACGATCAACATGGAGGAGTGCCGGCTGCGGGTGCAGGTCCAGCCCTTGGAGCTGCCCATGGTCACCACCATCCAGGTGATGATGTCCAGCCAGTTGAGTGGCCGGAGGGTGTTGGTCACTGGATTTCCTGCCAGCCTCAGGCTGAGTGAGGAGGAGCTGCTGGACAAGCTAGAGATCTTCTTTGGCAAGACTAGGAACGGAGGTGGCGATGTGGACGTTCGGGAGCTACTGCCAGGGAGTGTCATGCTGGGGTTTGCTAGGGATGGAGTGGCTCAGCGTCTGTGCCAAATCGGCCAGTTCACAGTGCCACTGGGTGGGCAGCAAGTCCCTCTGAGAGTCTCTCCGTATGTGAACGGGGAGATCCAGAAGGCTGAGATCAGGTCGCAGCCAGTTCCCCGCTCGGTACTGGTGCTCAACATTCCTGATATCTTGGATGGCCCGGAGCTGCATGACGTCCTGGAGATCCACTTCCAGAAGCCCACCCGCGGGGGCGGGGAGGTAGAGGCCCTGACAGTCGTACCCCAAGGACAGCAGGGCCTAGCAGTCTTCACCTCTGAGTCAGGCTAG
ORF Protein Sequence MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0975-Ab Anti-IN35/ IFI35/ IFP35 functional antibody
    Target Antigen GM-Tg-g-SE0975-Ag IFI35 protein
    ORF Viral Vector pGMLP004640 Human IFI35 Lentivirus plasmid
    ORF Viral Vector pGMLV000853 Human IFI35 Lentivirus plasmid
    ORF Viral Vector vGMLP004640 Human IFI35 Lentivirus particle
    ORF Viral Vector vGMLV000853 Human IFI35 Lentivirus particle


    Target information

    Target ID GM-SE0975
    Target Name IFI35
    Gene ID 3430, 70110, 712409, 287719, 101093657, 490954, 510697, 100052050
    Gene Symbol and Synonyms 2010008K16Rik,ifi-35,IFI35,IFP35
    Uniprot Accession P80217
    Uniprot Entry Name IN35_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000068079
    Target Classification Not Available

    Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. Located in several cellular components, including cytosol; extracellular space; and nucleus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.