Human Gpr31/12-HETER/HETER ORF/cDNA clone-Lentivirus particle (NM_005299)

Cat. No.: vGMLP004688

Pre-made Human Gpr31/12-HETER/HETER Lentiviral expression plasmid for Gpr31 lentivirus packaging, Gpr31 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GPR31/Gpr31/12-HETER products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004688 Human Gpr31 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004688
Gene Name Gpr31
Accession Number NM_005299
Gene ID 2853
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 960 bp
Gene Alias 12-HETER,HETER,HETER1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCATTCCCAAACTGCTCAGCCCCCAGCACTGTGGTGGCCACAGCTGTGGGTGTCTTGCTGGGGCTGGAGTGTGGGCTGGGTCTGCTGGGCAACGCGGTGGCGCTGTGGACCTTCCTGTTCCGGGTCAGGGTGTGGAAGCCGTACGCTGTCTACCTGCTCAACCTGGCCCTGGCTGACCTGCTGTTGGCTGCGTGCCTGCCTTTCCTGGCCGCCTTCTACCTGAGCCTCCAGGCTTGGCATCTGGGCCGTGTGGGCTGCTGGGCCCTGCACTTCCTGCTGGACCTCAGCCGCAGCGTGGGGATGGCCTTCCTGGCCGCCGTGGCTTTGGACCGGTACCTCCGTGTGGTCCACCCTCGGCTTAAGGTCAACCTGCTGTCTCCTCAGGCGGCCCTGGGGGTCTCGGGCCTCGTCTGGCTCCTGATGGTCGCCCTCACCTGCCCGGGCTTGCTCATCTCTGAGGCCGCCCAGAACTCCACCAGGTGCCACAGTTTCTACTCCAGGGCAGACGGCTCCTTCAGCATCATCTGGCAGGAAGCACTCTCCTGCCTTCAGTTTGTCCTCCCCTTTGGCCTCATCGTGTTCTGCAATGCAGGCATCATCAGGGCTCTCCAGAAAAGACTCCGGGAGCCTGAGAAACAGCCCAAGCTTCAGCGGGCCCAGGCACTGGTCACCTTGGTGGTGGTGCTGTTTGCTCTGTGCTTTCTGCCCTGCTTCCTGGCCAGAGTCCTGATGCACATCTTCCAGAATCTGGGGAGCTGCAGGGCCCTTTGTGCAGTGGCTCATACCTCGGATGTCACGGGCAGCCTCACCTACCTGCACAGTGTGCTCAACCCCGTGGTATACTGCTTCTCCAGCCCCACCTTCAGGAGCTCCTATCGGAGGGTCTTCCACACCCTCCGAGGCAAAGGGCAGGCAGCAGAGCCCCCAGATTTCAACCCCAGAGACTCCTATTCCTGA
ORF Protein Sequence MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80858-Ab Anti-GPR31/ 12-HETER/ HETER monoclonal antibody
    Target Antigen GM-Tg-g-T80858-Ag GPR31 VLP (virus-like particle)
    ORF Viral Vector pGMLP004688 Human Gpr31 Lentivirus plasmid
    ORF Viral Vector vGMLP004688 Human Gpr31 Lentivirus particle


    Target information

    Target ID GM-T80858
    Target Name GPR31
    Gene ID 2853, 436440, 717158, 292310, 101080638, 484081, 617303, 100055116
    Gene Symbol and Synonyms 12-HETER,GPR31,Gpr31b,Gpr31c,GPR31c(t),HETER,HETER1
    Uniprot Accession O00270
    Uniprot Entry Name GPR31_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000120436
    Target Classification GPCR

    Enables G protein-coupled receptor activity and arachidonic acid binding activity. Involved in G protein-coupled receptor signaling pathway and response to acidic pH. Located in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.